KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100404963
Entry
100404963         CDS       T03264                                 

Gene name
HHIP
Definition
(RefSeq) hedgehog interacting protein
  KO
K06231  hedgehog interacting protein
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04024  cAMP signaling pathway
cjc04340  Hedgehog signaling pathway
cjc05200  Pathways in cancer
cjc05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100404963 (HHIP)
   04024 cAMP signaling pathway
    100404963 (HHIP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100404963 (HHIP)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100404963 (HHIP)
SSDB
Motif
Pfam: Folate_rec GSDH EGF_2
Other DBs
NCBI-GeneID: 100404963
NCBI-ProteinID: XP_002745364
Ensembl: ENSCJAG00000002666
UniProt: U3FQI0
LinkDB
Position
3
AA seq 700 aa
MLKMLSFKLLLLAVALGFFEGDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLE
LLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ
SLFHSPEREVLERDLVLPLLCKDYCKEFFYTCRGHIPGFLQTTADEFCFYYARKDGGLCF
PDFPRKQVRGPASNYLDQMEEYDKVEEISRKHKHNCFCIQEVVSGLRQPIGALHSGDGSH
RLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLY
VSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHRKHLGGQLLFG
PDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLEVDTDMCSVPYSIPRSNPHFNSTNQ
PPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSL
LEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGTS
GSCRGYFSGHILGFGEDELGEVYILSSSKSVTQTHNGKLYKIVDPKRPLMPEECRVTVQP
AQTLASECSRLCRNGYCTPTGKCCCSAGWEGDFCRIAKCEPACRHGGVCVRPNKCLCKKG
YLGPQCEQVDRNIRRVTRAGILDQIIDMTSYLLDLTSYIV
NT seq 2103 nt   +upstreamnt  +downstreamnt
atgctgaagatgctctcctttaagctgctgctgctggctgtggctctgggcttctttgaa
ggagatgctaagtttggggaaagaaacgaagggagcggagcaaggaggagaaggtgcctg
aatgggaaccccccgaagcgcctgaaaaggagagacaggaggatgatgtcccagctggag
ctgctgagtgggggagagatgctgtgcgggggcttctaccctcggctgtcctgctgcctg
cggagtgacagcccggggctggggcgcctggagaacaagatattttctgttaccaacaac
acagaatgtgggaagttactggaggaaatcaaatgtgcactttgctctccacattctcaa
agcctgttccactcacctgagagggaagtcttggaaagagacctagtacttcctctgctc
tgcaaagactattgcaaagaattcttttacacttgccgaggccatattccaggtttcctt
caaacaactgcagatgagttttgcttttactatgcaagaaaagatggtgggctgtgcttt
ccggattttccaagaaaacaagtcagaggaccagcatctaactacttggaccagatggaa
gaatacgacaaagtggaagagatcagcagaaagcacaagcacaactgcttctgtattcag
gaggttgtgagtgggctgcggcagcccattggtgccctgcatagtggggatggctcgcac
cgtctcttcattctggaaaaagaaggttatgtgaagatacttacccctgaaggagaaatt
ttcaaggagccttatttggacattcacaaacttgttcaaagtggaataaagggaggagat
gaaagaggactgctaagcctcgcattccatcccaattacaagaaaaatggaaagttgtat
gtgtcttataccaccaaccaagaacggtgggctatcgggcctcatgaccacattcttagg
gttgtggaatacacagtatccagaaaaaatccccaccaagttgatttgagaacagccaga
gtctttcttgaagtcgcagaactccacagaaagcatctgggaggacaactgctctttggc
cctgatggctttttgtacatcattcttggtgacgggatgattacactggatgatatggaa
gaaatggatgggttaagtgatttcacaggctcagtgctacggctggaagtggacacagac
atgtgcagcgtgccttattccataccaaggagcaacccacatttcaacagcaccaaccag
ccccctgaagtgtttgctcacgggctccacgatccaggcagatgtgccgtggatcgacat
cccactgatataaacatcaatttaactatactttgttcagactccaatggaaaaaacaga
tcatcagccagaatcctacagataataaaggggaaagattatgaaagtgagccatcactt
ttagaattcaagccattcagtaatggtcctttggttggtggatttgtataccggggctgc
cagtcagaaagattgtatggaagctatgtgtttggagatcgtaatgggaatttcttaact
ctccagcaaagtcctgtgacaaagcaatggcaagaaaaaccactctgtctcggcactagt
gggtcttgtagaggttacttttccggacatatcttgggatttggagaagatgaactaggt
gaagtgtacattttatcaagcagtaaaagtgtgacccagactcacaatggaaaactctac
aaaattgtagatcccaaaagacctttaatgcctgaggaatgcagagtcacggtacaaccg
gcacagacactggcctcagagtgctccaggctctgtcgaaacggctactgcacccccaca
ggaaagtgctgctgcagtgcaggctgggagggggacttctgcagaatcgcaaaatgtgag
ccagcttgtcgtcatggaggtgtctgtgttagaccaaacaagtgcctctgtaaaaaagga
tatcttggtcctcaatgtgaacaagtggacagaaacatccgcagagtgaccagggcaggt
attcttgatcagatcattgacatgacatcttacttgctggatctaacaagttacattgta
tag

DBGET integrated database retrieval system