KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100406916
Entry
100406916         CDS       T03264                                 

Gene name
RYR2
Definition
(RefSeq) ryanodine receptor 2
  KO
K04962  ryanodine receptor 2
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04020  Calcium signaling pathway
cjc04024  cAMP signaling pathway
cjc04260  Cardiac muscle contraction
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04371  Apelin signaling pathway
cjc04713  Circadian entrainment
cjc04911  Insulin secretion
cjc04921  Oxytocin signaling pathway
cjc04972  Pancreatic secretion
cjc05020  Prion disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05410  Hypertrophic cardiomyopathy
cjc05412  Arrhythmogenic right ventricular cardiomyopathy
cjc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100406916 (RYR2)
   04020 Calcium signaling pathway
    100406916 (RYR2)
   04024 cAMP signaling pathway
    100406916 (RYR2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100406916 (RYR2)
   04921 Oxytocin signaling pathway
    100406916 (RYR2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100406916 (RYR2)
   04261 Adrenergic signaling in cardiomyocytes
    100406916 (RYR2)
  09154 Digestive system
   04972 Pancreatic secretion
    100406916 (RYR2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100406916 (RYR2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    100406916 (RYR2)
   05022 Pathways of neurodegeneration - multiple diseases
    100406916 (RYR2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100406916 (RYR2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100406916 (RYR2)
   05414 Dilated cardiomyopathy
    100406916 (RYR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjc04040]
    100406916 (RYR2)
   04990 Domain-containing proteins not elsewhere classified [BR:cjc04990]
    100406916 (RYR2)
Ion channels [BR:cjc04040]
 Voltage-gated cation channels
  Ryanodine receptor
   100406916 (RYR2)
Domain-containing proteins not elsewhere classified [BR:cjc04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   100406916 (RYR2)
SSDB
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8
Other DBs
NCBI-GeneID: 100406916
NCBI-ProteinID: XP_017822208
Ensembl: ENSCJAG00000017504
LinkDB
Position
19
AA seq 4958 aa
MADGGEGEDEIQFLRTDDEVVLQCTATIHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPP
DLSICTFVLEQSLSVRALQEMLANTVEKSEGQVDVEKWKFMMKTAQGGGHRTLLYGHAIL
LRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDATGEACWWTIHPASKQRSEGEKVRVGDD
LILVSVSSERYLHLSYGNGSLHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGH
MDECLTVPSGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHV
TTGKYLSLMEDKNLLLMDKEKADVKSTAFTFRSSKEKLDVGVRKEVDGMGTSEIKYGDSV
CYIQHVDTGLWLTYQSVDVKSVRMGSIQRKAIMHHEGHMDDGINLSRSQHEESRTARVIR
STVFLFNRFIRGLDALSKKAKASTVDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLR
ALKNRQNLFQEEGMINLVLDCIDRLHVYSSAAHFADVAGREAGESWKSILNSLYELLAAL
IRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISL
LDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIF
LGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGD
DLFSYGFDGLHLWSGCIARTVSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFE
NFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKVEHSREY
KQERTYTRDLLGPTVSLTQAAFTPIPVDTSQIVLPPHLERIREKLAENIHELWVMNKIEL
GWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGISDEHAEEK
VKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGI
QQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHAARAEVCSG
TGERFRIFRAEKTYAVKAGRWYFEFEAVTAGDMRVGWSRPGCQPDQELGSDERAFAFDGF
KAQRWHQGNEHYGRSWQAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFDVGDG
FIPVCSLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQ
VPSNHEHIEVTRIDGTIDSSPCLKVTQKSFGSQNSNTDIMFYRLSMPIECAEVFSKTVPG
GLPGAGLFGPKSDLEDYDADSDFEVLMKTAHGHLVPDRVDKDKEATKPEFNNHKDYAQEK
PSRLKQRFLLRRTKPDYSTSHSARLTEDVLADDRDDYDFLMQTSTYYYSVRIFPGQEPAN
VWVGWITSDFHQYDTGFDLDRVRTVTVTLGDEKGKVHESFAIDSLCGFGIKRSNCYMVCA
GESMSPGQGRNNNGLEIGCVVDAASGLLTFIANGKELSTYYQVEPSTKLFPAVFAQATSP
NVFQFELGRIKNVMPLSAGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSR
ISERQGWLVQCLDPLQFMSLHIPEENRSVDILELTEQEELLKFHYHTLRLYSAVCALGNH
RVAHALCSHVDEPQLLYAIENKYMPGLLRTGYYDLLIDIHLSSYATARLMMNNEYIVPMT
EETKSITLFPDENKKHGLPGIGLSTSLRPRMQFSSPSFVSISNECYQYSPEFPLDILKAK
TIQMLTEAVREGGLHARDPVGGTTEFLFVPLIKLFYTLLIMGIFHNEDLKHILQLIEPSV
FKEAATLEEESDALEKELHVEDARLQGAGEEEAKGGKRPKEGLLQMKLPEPVKLQMCLLL
QYLCDCQVRHRIEAIVAFSDDFVAKLQDNQRFRYNEVMQALNMSAALTARKTKEFRSPPQ
EQINMLLNFKDDKSECPCPEEIRDQLLDFHEDLMTHCGIELDEDGSLDGNSDLTIRGRLL
SLVEKVTYLKKKQAEKPIESDSKKSSTLQQLISETMVRWAQESVIEDPELVRAMFVLLHR
QYDGIGGLVRALPKTYTINGVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIM
NNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEITFPKMVANCCRFLCYFCRISRQN
QKAMFDHLSYLLENSSVGLASPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLA
GCGLQSCQMLVSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPEC
FGPALRGEGGNGLLAAMEEAIKIAEDPSRDGPSPNSGSSKTLDTEEEEDDTIHMGNAIMT
FYAALIDLLGRCAPEMHLIHAGKGEAIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGN
VVEPDMSAGFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSAT
DMALALNRYLCTAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIE
VCLLSICGQLRPSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNF
GAASEEELHLSRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSMME
KQSSMDSEGNFNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDS
SKVQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQT
SQVSVDAAHGYSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKMELESKGGGNHPL
LVPYDTLTAKEKAKDREKAQDILKFLQINGYAVSRGFKDLELDTPSIEKRFAYSFLQQLI
RYVDEAHQYILEFDGGSRGKGEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPL
CSGGHASNKEKEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGL
ESVKSALRAFLDNAAEDLEKTMENLKQGQFTHTRNQPKGVTQIINYTTVALLPMLSSLFE
HIGQHQFGEDLILEDVQVSCYRILTSLYALGTSKSIYVERQRSALGECLAAFAGAFPVAF
LETHLDKHNIYSIYNTKSSRERAALSLPSNVEDVCPNIPSLEKLMEEIVELAESGIRYTQ
IPHVMEVILPMLCSYMSRWWEHGPENNPERAEMCCTALNSEHMNTLLGNILKIIYNNLGI
DEGAWMKRLAVFSQPIINKVKPQLLKTHFLPLMEKLKKKAAMVVSEEDHLKAEARGDMSE
AELLILDEFTTLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSH
NFKREEQNFVVQNEINNMSFLITDTKSKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAAL
KRLLPIGLNICAPGDQELIALAKNRFSLKDTEDEVRDIIRSNIHLQGKLEDPAIRWQMAL
YKDLPNRTDDASDPEKTVERVLDIANVLFHLEQKSKRVGRKHYCLVEHPQRSKKAVWHKL
LSKQRKRAVVACFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAKPGAD
PPEEDECTKRVDPLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDNDGEEE
VKSFEVTGSQRSKEKEMEKQKLLYQQARLHDRGAAEMVLQTISASKGETGPMVAATLKLG
IAILNGGNSTVQQKMLDYLKEKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVTE
EGSGEKVLQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQ
ESISDFYWYYSGKDVIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWD
AVVGFLHVFAHMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDM
LVESSNNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSE
TEFLLSCAETDENETLDYEEFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELA
ESVLNYFQPFLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGE
KEKMELFVNFCEDTIFEMQLAAQISESDLNERSANKEESEKERPEEQGPRMGFFSILTVK
SALFALRYNILTLMRMLSLKSLKKQMKKVKKMTMKDMVTAFFSSYWSIFLTLLHFVASVF
RGFFRIICSLLLGGSLVEGAKKIKVAELLANMPDPTQDEVRGDGEEGERKALEATLPSED
LTDLKELTEESDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLMSNPVPMPEVQEKFQEQ
KAKEEGKEEREETKSEPEKAEGEDGEKEEKVKEDKGKQKLRQLHTHRYGEPEVPESAFWK
KIIAYQQKLLNYFARNFYNMRMLALFVAFAINFILLFYKVSTSSVVEGKELPTRSSSENA
KVTSLDSSSHRIIAVHYVLEESSGYMEPTLRILAILHTVISFFCIIGYYCLKVPLVIFKR
EKEVARKLEFDGLYITEQPSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYG
RDRISELLGMDKAALDFSDAREKKKPKKDSSFSAVLNSIDVKYQMWKLGVVFTDNSFLYL
AWYMTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYT
VVAFNFFRKFYNKSEDGDTPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIY
RIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVP
HGFETHTLQEHNLANYLFFLMYLINKDETEHTGQVGKL
NT seq 14877 nt   +upstreamnt  +downstreamnt
atggccgatgggggcgagggcgaagacgagatccagttcctgcgaactgatgacgaagtg
gtcctgcagtgcaccgcaaccatccacaaagagcagcagaagctatgcttggcagcagaa
ggatttggcaacagactttgtttcctggagtccacttccaactccaagaatgtacccccg
gacctctccatctgcacattcgtgctggagcagtccctctctgtccgggccctgcaggag
atgttggctaacaccgtggagaaatcagaagggcaagttgatgtggaaaaatggaaattc
atgatgaagactgctcaaggtggtggtcatcgaacactcctctacggacatgccatattg
ctgcgccattcctacagcggcatgtatctgtgctgcctgtccacttcccggtcttcaacc
gacaagctggcttttgatgttggcttgcaggaggacgccacaggtgaggcttgttggtgg
accatacaccctgcttctaagcagcgatcagaaggagaaaaagtaagagttggagatgac
ctcatcttagttagtgtgtcctctgaaaggtacttgcacttgtcttacggcaacggcagc
ttacacgtggatgctgctttccagcaaactctgtggagcgtggccccaatcagctcagga
agtgaggcagcccaagggtatctcattggtggtgatgtcctcaggttgcttcatggacac
atggacgagtgtctcactgtcccttcaggagaacatggtgaagagcagcggagaaccgtt
cattatgaaggtggcgctgtgtctgttcatgcacgttccctttggagactagagacgcta
agagttgcgtggagtggaagccacataagatggggccagccattcagactacgccatgtc
acaacaggaaaatacttgagtctcatggaagacaaaaaccttctactcatggacaaagag
aaagctgatgtaaaatcaacagcatttaccttccggtcttccaaggaaaaattagatgtt
ggggtgagaaaagaagttgacggcatgggaacatctgaaataaaatacggtgactcagta
tgctatatacaacatgtggacacaggcctgtggcttacttaccagtccgtggacgtgaaa
tccgtgagaatgggatcaatacaacgtaaggctataatgcaccatgaaggccacatggat
gatggcataaatttatcaagatctcagcatgaagaatcacgcacagcaagagttatccgg
agcacagtcttccttttcaatagatttataaggggccttgatgctctcagcaagaaagcg
aaggcttccacagtcgatttgcctatagagtccgtaagtctaagtctgcaggacctcatt
ggctacttccaccccccagatgagcatttagaacatgaagacaaacagaacagactacga
gccctgaagaatcggcaaaatctcttccaggaagagggaatgatcaacctggtgctcgat
tgcatagaccgactgcatgtctacagcagcgcggcacacttcgctgatgttgctggacga
gaagcaggggagtcttggaaatccattctgaactctctgtatgagttgctggcggctcta
attagaggaaatcgtaaaaactgtgctcaattttctggctccctcgactggttgatcagc
agattggaaaggctggaagcttcttctggcattctggaagttttacactgtgtattagta
gaaagtccagaagctctaaatattattaaagaaggacatattaaatctattatctcactt
ttagacaagcatggaagaaatcacaaggttctggacgtcttgtgctcactctgtgtttgc
catggggttgcagtccgttctaaccagcatctcatctgtgataacctgttaccaggaaga
gatttgttattgcagacacgtcttgtgaaccatgtcagcagcatgagacccaatattttt
ctgggtgtcagtgaaggttctgctcagtataagaaatggtactatgaattgatggtggac
cacacagagccctttgtgacagctgaagcaactcacctgcgagtgggctgggcttctacg
gaagggtattctccctaccctggagggggcgaagaatggggtggaaatggtgttggagat
gacctcttctcctatggattcgatggccttcatctctggtcaggttgtattgctcgtact
gtaagctcaccaaaccagcatctgttaagaactgatgatgtcatcagttgctgtttagat
ctcagtgccccaagcatctcattccgaattaatggacagcctgttcaaggaatgtttgag
aatttcaacatcgatggcctcttctttccagttgtcagtttctctgcaggaataaaggta
cgctttctgcttggggggcgacatggagaattcaaatttcttcctccacctgggtatgcg
ccttgttatgaagctgttctgccaaaagaaaagttgaaagtggaacacagccgagagtac
aagcaagaacgaacttacacacgcgacctgctgggccccacagtgtccctgacacaagcc
gccttcacaccgatccctgtggacaccagccagatcgtgttgcctcctcatctagaaaga
ataagagaaaaactggcagagaatatccatgaactctgggttatgaataaaattgagctt
ggctggcagtatggtccggttagagatgacaacaagagacaacacccatgcctggtggag
ttctccaagctgcctgagcaggagcgcaattacaacctacagatgtcactggagaccctg
aagactttgttggcattaggatgtcacgtgggtatatcagacgaacatgctgaggaaaag
gtgaagaaaatgaagctacccaagaattaccagctgacaagcggatacaagcctgcccct
atggacctgagctttataaaactcaccccatctcaggaagcaatggtggacaagttggca
gaaaacgctcacaacgtgtgggcccgggatcgaatccggcagggctggacttacggcatc
caacaggacgtaaagaacagaagaaatcctcgccttgttccctacactcttctggatgac
cgaaccaagaaatccaacaaggacagcctccgcgaggctgtgcgcacgctgctggggtac
ggctacaacttggaagcaccggatcaagatcacgcagccagagccgaagtatgcagtggc
actggggaaagattccgaatcttccgtgctgagaagacctatgccgtgaaggcgggacgg
tggtattttgaatttgaggcggtcactgctggagacatgagggttggttggagtaggcct
ggttgtcaaccggatcaggagcttggctcagatgaacgtgcctttgcctttgatggcttc
aaggcccagcggtggcatcagggcaacgaacactatgggcgctcttggcaagcaggcgat
gttgtggggtgtatggtcgacatgaatgaacacaccatgatgttcacactgaatggtgaa
atccttctggatgattcagggtcagaactggctttcaaggactttgatgttggtgacgga
ttcatacctgtgtgtagcctcggagtggctcaagtgggcaggatgaactttggaaaggat
gtcagcaccttgaaatatttcaccatctgtggcttacaagagggctatgaaccatttgcc
gttaatacaaacagggatattaccatgtggctgagcaagaggcttcctcagtttctccaa
gtaccatcaaaccatgagcatatagaggtgaccagaatagacggcaccatagacagttcc
ccgtgcttaaaggtcactcagaagtcttttggttctcagaacagcaacaccgatatcatg
ttttaccgcctgagcatgccgatagagtgcgcagaggtcttctccaagactgtgcctgga
gggctccctggggctggcctttttgggcccaagagtgatttggaagactatgatgctgat
tctgacttcgaggttctgatgaagacagctcatggccatctggtgcctgatcgtgttgac
aaagacaaagaagccactaaaccagagtttaataaccacaaagattatgcccaggaaaag
ccctctcgtctgaaacaaagatttttgttgagaagaacaaagccggattacagcacaagc
cattctgcaagactcactgaagatgtccttgctgatgatcgggatgactatgacttcttg
atgcaaacgtccacgtactattactcagtgagaatctttcctggacaagaacctgctaat
gtctgggtgggctggattacatcagatttccatcagtatgacacgggcttcgacttggac
agagttcgcacagtaacagttacactaggagatgaaaaagggaaagtgcatgaaagcttt
gccattgactcgctgtgtggctttggcatcaaacgcagcaactgctatatggtatgtgcg
ggtgagagcatgagccccgggcaaggacgcaacaataatggactggagatcggctgtgtg
gtggatgctgccagcgggctgctcacgttcattgccaatggcaaggaactgagcacatac
tatcaggtggagccaagcacaaaattatttccagcggtttttgcacaagctacaagtccc
aatgttttccagtttgagttgggaagaataaagaacgtgatgcccctctcggcgggatta
ttcaagagtgagcacaagaaccccgtgccacagtgccccccacgcctccacgtgcagttc
ctgtcacacgtcctgtggagcagaatgcccaaccagtttttgaaggtagatgtgtctcgc
ataagtgaacgccaaggctggttggtgcagtgtctggatcctctgcagttcatgtctctt
catatccctgaggaaaacagatctgttgacatcttagagttgacagagcaggaggagttg
ctgaaatttcactatcacactctccggctctactcagccgtctgtgctcttgggaaccac
cgggtggctcatgccctgtgcagccacgtggatgaacctcagctcctctatgccatcgag
aacaagtacatgccaggtttgctgcgcactggctactatgacctgctgattgacatccac
ctgagctcctatgccactgccaggctcatgatgaacaacgagtacattgtccccatgacg
gaggagaccaagagcatcaccctgtttcctgatgagaacaaaaagcatggccttccgggt
atcggcctcagcacctccctcaggccacggatgcagttttcctcccccagttttgtaagc
attagtaatgaatgttaccagtacagtccagagttccccctggacatcctaaaagccaaa
accatacagatgctgacagaagctgtcagagagggcggtcttcatgcacgggacccagtt
ggagggactactgaattcctctttgtacctctcatcaagctcttctataccctgctcatc
atgggcatctttcacaatgaggacttgaagcacatcttgcagttgattgagcccagtgtg
tttaaagaagctgccactctggaggaggagagtgacgcgctggagaaagagctccatgtg
gaagacgcaaggctgcaaggagctggtgaggaagaagccaaggggggtaagcggcccaag
gaaggcctgctccaaatgaaactgccagagccagttaaattgcagatgtgcctactgctt
cagtacctctgcgactgccaggtccggcaccggatagaagccatcgtagccttttcagat
gattttgtagctaagctccaagacaatcaacgcttccgatacaatgaagttatgcaagcc
ttaaacatgtccgctgcactcacagccaggaaaacaaaggaatttagatcaccacctcaa
gaacagatcaatatgcttctcaattttaaggatgacaaaagtgaatgtccatgtccagaa
gaaattcgtgatcaactattggatttccatgaagatttgatgacacattgtggaattgag
ctggatgaagacgggtctctagatggaaacagtgatttaacaattagaggacgtctgctg
tccctggtagaaaaggtgacatacctgaagaagaagcaagcagaaaaaccaattgagagt
gactccaagaagtcctccactctgcagcagctgatctctgagactatggtccggtgggct
caggagtctgttattgaagaccccgagctggtgagggccatgtttgtattgctgcatcgg
cagtatgatggcattgggggtcttgtccgggccctgccaaagacctacacaataaatggt
gtttccgtggaggataccatcaacctgctggcatcccttggtcagattcgatccctgctg
agtgtgagaatgggcaaagaagaagagaagcttatgattcgtggattaggggatataatg
aataacaaagtgttttaccagcaccctaatctcatgagggcactggggatgcatgagact
gtgatggaggtcatggtgaacgtccttggaggtggagagtccaaggaaatcacctttccc
aagatggtggccaactgttgccgttttctctgttacttttgtcgtataagtaggcagaat
caaaaagctatgtttgatcatctcagttatttactggaaaatagcagtgttggtcttgcc
tccccagctatgagaggttccacacctctggatgtggccgcagcgtcagtgatggataat
aatgaactagcattagctctgcgtgagccagatctggaaaaggtggttcgttatttggct
ggttgtggactgcaaagttgccagatgctggtgtctaagggttatccagacattgggtgg
aatccagtggaaggagagagatatcttgactttctcagatttgctgtcttctgtaatggg
gagagtgtggaagaaaatgcaaatgttgtggtgagattgctcattcggaggcctgagtgt
tttggtcctgctttgagaggagaaggtgggaatggtcttcttgcagcaatggaagaagcc
atcaaaatcgctgaggatccttcccgagatggtccctcacccaacagcggatccagcaaa
acacttgatacggaggaggaggaagatgacactatccacatggggaacgcaatcatgacc
ttctatgcagctttaattgacctcttaggacgctgtgctcctgagatgcatttgattcat
gctggtaagggagaagccatcagaattaggtctattttgagatccctaattcccttggga
gatttggtgggagttatcagcatcgcttttcagatgccaacaatagccaaagatgggaat
gtggtggaacctgacatgtctgcggggttttgcccagatcacaaggcagccatggtttta
ttccttgacagggtctatggaattgaggttcaagacttcctccttcatcttcttgaggtt
ggctttctgccagatctccgggcagctgcttctttagatacggctgctttgagtgccaca
gacatggccttggccctcaatcggtacctttgcacagccgtcttgccgttgttaacaaga
tgtgctcctctctttgctggcacagagcaccatgcttctctcattgactcattgcttcac
accgtgtatagactttcgaagggctgctcactaaccaaagctcagcgggattccatagaa
gtttgtttactctctatttgtggacagttgagaccttctatgatgcagcacttactaaga
agattagtatttgatgttccattattaaatgaacacgccaagatgcctcttaaactgctg
acaaatcattatgaaagatgttggaaatattactgcctgcccggagggtggggaaacttt
ggtgctgcctcagaagaagaacttcatttatcaagaaagttgttctggggcatttttgat
gccctgtctcaaaagaaatatgaacaagaacttttcaaactggcactgccttgcctgagt
gcagttgcgggagctttgcctccagactacatggagtcaaattatgtcagtatgatggaa
aaacagtcatcaatggattctgaagggaactttaacccacaacctgttgatacctcaaat
attacaattcctgagaagttggaatacttcattaacaaatatgcagaacactcccatgac
aaatggtcaatggacaagttggcaaatggatggatttatggagaaatatattcagactct
tctaaggttcaaccattaatgaagccatataagctgttgtctgaaaaggaaaaagaaatt
tatcgttggccaatcaaagaatctttaaaaacaatgctggcttggggttggagaattgaa
agaactcgggagggagacagcatggccctttacaaccggactcgccgtatttctcagaca
agccaggtttctgtagacgctgcccatggttacagtccccgggctattgacatgagcaat
gttacgctctctagagacttgcatgctatggcagaaatgatggctgaaaattatcataat
atatgggcaaagaaaaagaaaatggagttggagtccaaaggaggaggaaaccatcccctg
ctggttccctatgacacactgacagccaaagagaaagccaaggatagagaaaaagcacag
gacatcctcaagttcttgcagatcaatggatatgctgtatccagaggatttaaggacctg
gaactggacacgccttctattgagaaacgatttgcctacagtttcctccaacaactcatt
cgctatgtggatgaagcccatcagtacatccttgagtttgatggtggcagcagaggcaaa
ggagaacatttcccttatgaacaagaaatcaagttctttgcaaaagtcgttcttccttta
attgatcagtatttcaaaaaccatcgtttatacttcttatctgcagcaagcagacctctc
tgctctggaggacatgcttccaacaaagagaaagaaatggtgactagcctattctgcaaa
cttggagttcttgtcaggcataggatttcactatttggtaatgatgcaacgtcaattgtc
aactgtcttcatattttgggtcaaactttggatgcaaggacagtgatgaagactggcctg
gagagtgttaaaagcgcactcagagcttttctggacaatgctgcagaggacctggagaag
accatggaaaatctcaagcagggccagttcacccacacccgaaaccagcccaaaggggtt
actcagattatcaattacaccacggtggccctgctgccaatgctgtcgtcattatttgaa
catattggccagcatcagttcggagaagacctaatattggaagatgtgcaggtgtcttgt
tacagaattctgactagcttatatgccttgggaaccagcaagagtatttacgtggaaaga
caacgttctgcattaggagaatgtctagctgcctttgctggtgcctttcctgtagcattt
ttggaaactcatctggacaaacataatatttactccatctacaataccaagtcttcgcga
gaaagagcagctctcagtttgccaagtaatgtggaagatgtttgcccaaatataccatct
ttggagaaactcatggaagaaatcgtggaattagctgagtccggcattcgctacactcaa
ataccacatgtcatggaagtcatattgcccatgctttgcagctacatgtctcggtggtgg
gagcatggacctgagaacaatccggaacgggccgagatgtgctgcacagccctgaactca
gagcacatgaacacgcttctaggaaacatactgaaaatcatatataataacttggggatt
gatgagggagcctggatgaagaggctggcagtgttttcccagcctataataaataaagtg
aaacctcagctcttgaaaactcatttcttgccattgatggagaaactcaagaaaaaggca
gccatggtggtgtccgaggaagaccacctgaaagccgaggccaggggcgatatgtcggag
gctgagcttctcatcctagatgagttcaccacactggccagagatctctatgccttctac
cctctcttgattagatttgtggactataacagggcaaagtggctaaaggaacctaaccca
gaagcagaggagctcttccgcatggtggccgaagtgtttatctactggtcgaaatcccat
aatttcaaaagagaagagcagaacttcgttgtacagaatgaaatcaacaacatgtctttc
cttattactgacaccaagtcaaagatgtcaaaggcagctgtttctgatcaggaaaggaag
aaaatgaagcgcaaaggagatcggtattccatgcagacctctctaattgtagcagctctg
aagcggctgctgcccattgggttgaacatctgtgcccctggggaccaggagctcattgct
ctggccaaaaatcgatttagcctgaaagatactgaggatgaagtacgagatataatccgc
agcaatattcatttacaaggcaagttggaggatcctgctattagatggcaaatggctctt
tacaaagacttgccaaacaggactgatgatgcctcagatccagagaagacagtagaaaga
gtattggatatagcaaatgtgctttttcatcttgaacagaagtctaagcgtgtgggccgg
aagcattactgtctggtggaacatcctcagagatctaaaaaggccgtatggcataagcta
ctctctaagcagaggaaaagggctgtggtcgcctgcttccggatggcccctttatataat
ctgccaaggcatcgggctgtcaatctctttcttcagggatatgaaaagtcttggattgaa
acagaagaacattactttgaagataaactgatagaagatttagcaaaacctggggctgac
cctccagaagaagatgaatgcactaagagagttgatcctctacatcagctgatccttctg
tttagtcggacagctttaacagagaaatgcaaactggaggaagattttttatatatggct
tatgcagatattatggcaaagagttgtcatgatgaagaagacaatgacggtgaagaggaa
gtgaagagttttgaagtcacaggatcccagcgcagcaaggaaaaagaaatggaaaagcaa
aagcttctataccagcaagcccgactccatgatcgcggtgcggctgagatggtgctacag
acgatcagcgccagcaaaggtgaaactggaccaatggtagctgctactttgaaacttgga
attgctattttaaatggtgggaactccacagtacagcagaaaatgcttgactacctcaag
gagaaaaaggatgtgggcttctttcagagtctggccggcctgatgcagtcatgtagtgtc
cttgacctaaatgcatttgagcgacaaaacaaagctgaaggtcttggaatggtgacagag
gaaggatcaggagaaaaggttctgcaggatgacgagttcacctgtgacctcttccgattc
ctgcaactactctgtgagggacacaactcagattttcagaattatctgagaactcagact
ggcaataatacaactgtcaacatcattatctccactgtagactatctactgcgagttcag
gaatcaattagtgatttttattggtattactctgggaaagatgttattgatgaacaagga
caacggaatttctctaaagctattcaagtggcaaaacaagtctttaacacccttacagag
tacattcagggtccttgcactgggaatcagcagagtctggcacacagcaggctgtgggat
gctgtggtcggctttcttcacgtgtttgcccacatgcagatgaagctgtcacaggattcc
agtcaaattgagctactgaaagaactaatggatctgcagaaggatatggtggtcatgctg
ctgtccatgttagaaggtaatgttgttaatggaaccattggcaaacagatggtagatatg
cttgtggaatcttccaacaacgtggagatgattctcaaattttttgacatgttcttaaaa
ctaaaagatttgacgtcgtctgatacttttaaagaatatgaccctgatggcaagggagtc
atttccaagagggacttccacaaagcgatggagagtcataagcactacacgcagtcagaa
acggagtttcttttgtcttgcgcggagacggatgaaaatgaaaccctcgactatgaagag
tttgtcaaacgcttccacgaacctgcgaaggacattggcttcaatgtcgctgtccttctg
acaaacctctctgagcacatgcccaacgacacccgacttcagacttttctagaattagca
gagagtgtcctgaattattttcagcctttcctgggccgcattgaaatcatggggagtgcc
aaacgcatcgagagagtctatttcgaaatcagtgagtctagccggacccagtgggagaag
ccccaggtcaaggagtccaaaagacagttcatatttgatgtggttaatgaagggggagaa
aaagagaagatggaactcttcgttaacttctgcgaggacaccatatttgaaatgcagctg
gcggctcagatctcagagtcggatttgaacgagaggtcagcgaataaggaagaaagtgag
aaggagaggcccgaagagcaggggccgagaatgggcttcttctctatcctgacggtcaag
tcagccttgttcgccctcaggtacaatatcttgaccctcatgcggatgctcagtctgaag
agcctgaagaagcagatgaaaaaagtaaaaaagatgaccatgaaggacatggtcacagcc
ttcttttcatcctactggagtatttttctgaccctcttgcacttcgtggccagtgttttc
aggggctttttccgcatcatttgcagcctgctgctcgggggaagccttgtagaaggtgct
aaaaagatcaaagttgcagaactcttggccaacatgccagaccccactcaggacgaggtt
agaggagatggggaggagggagagaggaaagccctggaagccaccctgccctccgaggat
ctgacagatttaaaggagctgaccgaagaaagtgaccttctgtcagacatattcggactg
gatctgaagagagaaggaggacagtacaaactgattcctcacaatcccaatgctgggctc
agtgacctcatgagcaaccctgtccccatgcctgaggtgcaagaaaagtttcaggaacag
aaggcaaaagaagaaggaaaggaagaaagagaagaaaccaaatctgaacctgaaaaagcc
gagggagaagatggagagaaagaagagaaggtcaaagaagacaaggggaagcagaagttg
aggcagcttcacactcacagatacggagaaccggaagtgccagagtcagcattctggaag
aaaatcatagcgtatcaacagaaacttctaaactattttgctcgcaacttttacaacatg
agaatgttagccttatttgttgcattcgctatcaatttcatcttgctcttttataaggtc
tccacttcttctgtggttgaaggaaaggagctccccactcgaagttcaagtgaaaatgcc
aaagtgactagcctggacagcagctctcatagaatcatcgcagttcactatgtactggag
gagagcagcggctacatggagcccacgttgcgtatcttagctattctccacactgtcatt
tctttcttctgcatcattggatactactgcttgaaagttccattggttatttttaagcga
gaaaaggaagtagcacggaaattggaatttgatgggctttatattacagaacagccttca
gaagatgatattaaaggccagtgggacagactcgtaatcaacacacagtcatttcccaac
aactactgggacaaatttgttaaaagaaaggttatggataagtatggagagttctacggc
cgagacagaatcagtgaattactcggcatggacaaggcagctctggacttcagtgatgcc
agagaaaagaagaagccaaagaaggacagctccttttcggctgtactgaactctattgat
gtgaagtatcagatgtggaagctgggagttgttttcactgacaactccttcctctacctg
gcctggtatatgacgatgtccgttcttggtcactacaacaactttttttttgccgctcac
cttctcgacattgctatgggattcaagacattaagaaccatcttgtcctcagtaactcac
aatggcaaacagctcgtgttaactgttggcttattagctgttgttgtgtacctatatact
gtggtggcgttcaatttcttccgaaaattctacaataaaagtgaggacggtgatacgccg
gatatgaaatgtgacgatatgctaacatgctatatgttccacatgtacgttggagttcgc
gctggaggagggatcggggacgaaattgaagacccagcaggagacgaatatgagatctat
cggatcatctttgacatcactttcttcttcttcgttattgtcattctcttggccataata
caaggtcttattattgatgcttttggagaactaagagaccaacaggaacaagtcaaagaa
gatatggagaccaaatgcttcatctgcgggataggcaatgattacttcgacacggtgcca
catggctttgaaacccacactttacaggagcacaacctggctaattacttgttttttctg
atgtatcttataaacaaagatgaaacagaacacacaggacaggtaggtaaattatga

DBGET integrated database retrieval system