KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410240
Entry
100410240         CDS       T03264                                 

Gene name
NRG4
Definition
(RefSeq) neuregulin 4
  KO
K05458  neuregulin 4
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04012  ErbB signaling pathway
cjc05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100410240 (NRG4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100410240 (NRG4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100410240 (NRG4)
Cytokines and growth factors [BR:cjc04052]
 Growth factors
  Growth factors (RTK binding)
   100410240 (NRG4)
SSDB
Other DBs
NCBI-GeneID: 100410240
NCBI-ProteinID: XP_017832900
LinkDB
Position
10
AA seq 92 aa
MVLKQYGKGSRLDVCIENYTGARCEEVFLLSSSIQTKSNLFAAFMAVAVLVTLIIGAFYF
LCRKGPFQRVGSVQYDINLVEMSSTSTHHRNG
NT seq 279 nt   +upstreamnt  +downstreamnt
atggtattgaagcagtatggtaaaggctccagattagatgtgtgcattgaaaactataca
ggagctcgttgtgaagaggtttttctcctaagctccagcatccaaactaaaagtaacctg
tttgcagctttcatggcagtggcagtcctagtaacactgattattggagccttctacttc
ctttgcaggaagggcccctttcagagagtgggttcagtccagtatgatatcaacctggtg
gagatgagcagtaccagcacccaccacagaaatggatga

DBGET integrated database retrieval system