KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100410306
Entry
100410306         CDS       T03264                                 

Gene name
IFNAR1
Definition
(RefSeq) interferon alpha and beta receptor subunit 1
  KO
K05130  interferon receptor 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04151  PI3K-Akt signaling pathway
cjc04217  Necroptosis
cjc04380  Osteoclast differentiation
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04630  JAK-STAT signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05171  Coronavirus disease - COVID-19
cjc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100410306 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    100410306 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100410306 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100410306 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100410306 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    100410306 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    100410306 (IFNAR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100410306 (IFNAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100410306 (IFNAR1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100410306 (IFNAR1)
   05160 Hepatitis C
    100410306 (IFNAR1)
   05171 Coronavirus disease - COVID-19
    100410306 (IFNAR1)
   05164 Influenza A
    100410306 (IFNAR1)
   05162 Measles
    100410306 (IFNAR1)
   05168 Herpes simplex virus 1 infection
    100410306 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100410306 (IFNAR1)
   05169 Epstein-Barr virus infection
    100410306 (IFNAR1)
   05165 Human papillomavirus infection
    100410306 (IFNAR1)
Cytokine receptors [BR:cjc04050]
 Interleukin receptor families
  IFN receptor family
   100410306 (IFNAR1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 100410306
NCBI-ProteinID: XP_002761441
Ensembl: ENSCJAG00000000056
UniProt: U3CXP4
LinkDB
Position
21
AA seq 556 aa
MVALLGATTLMLVAVALWVLPAAAGGKHLKSQKVEVDIIDDNFILKWNRIDESLRNATFS
FDYQKSGTDNWRKLPGCQNITSTKCNFSSLKLSVYEEIKLRIRAEKENTSSWYEVDPFTP
YNKAQIGPPEVHLEAEDKAIMINISPPGTKNSVMWALDGLSFRYSLVIWKNSSSGEEEIK
NICSIHKIYKLSPETTYCLKVKAALPKASKVGLYGPVYCIKTTVENKLPPPKNIEVSVLN
QSYVLKWDYAYANMTFQVQWLQAFLKRNPVNHSNKWKQMPDCENVKTTQCVFPQNVLPNG
IYLLRLQASDGNNTSFWSEEIKLDTEIQAFLLPPVLNVRSASDSLHIYIGAPKESGSKPV
SQDYPLTYEIIFWENTSNAERKIFKNKTDFIVPNLKPLTVYCVKARAHAMDEKWNKSSAF
SDVVFVKTKPGNASKIWFIVGICTALFAIPALIYGVKVLLRCINYVFFPSLKPSSNIDEY
FSEQSLKNLLLSTSEEKIEKCFIIENICTIATVEETNQTDEDHKQYSSQNCQDSGNYSNE
DESESKTSEELQQDFV
NT seq 1671 nt   +upstreamnt  +downstreamnt
atggtcgccctcctgggcgcgacgaccctgatgctcgtcgccgtggcgctatgggtgttg
cccgcagccgcaggtgggaaacatctaaaatctcaaaaagtagaagtcgacatcatagat
gacaactttatcctgaagtggaacaggattgatgagtctctgaggaatgcgactttttca
ttcgattatcaaaaatctgggacggataattggagaaaattgcctgggtgtcagaatatt
actagtaccaaatgcaacttttcttcactcaagttgagtgtttatgaagaaattaaattg
cgtataagagcagaaaaagaaaacacttcttcatggtatgaggttgacccatttacacca
tataacaaagctcaaattggtcctccagaagtacatttggaagctgaagataaggcaata
atgataaacatctctcctcctggaacaaaaaatagtgtcatgtgggctttggatggttta
agctttagatacagcttagttatctggaaaaactcttcaagtggagaagaagagattaaa
aatatttgttccatacataaaatttataaactttcaccagagactacctattgtttaaaa
gttaaagcagcactacccaaggcatcaaaagttggtctctatggtccagtatattgtata
aagaccacagttgaaaataaactacctccaccaaaaaatatagaagtcagtgttctaaat
cagagctacgttcttaagtgggattatgcatatgcaaatatgacctttcaagttcagtgg
ctccaagcctttttaaaaaggaatcctgtgaaccattcgaataaatggaaacaaatgcct
gactgtgaaaatgtcaaaactacccagtgtgtctttcctcaaaatgttctcccaaatgga
atttaccttctccgcctacaagcatctgatggaaataacacatctttttggtctgaagag
ataaagcttgatactgaaatacaagctttcctacttcctccggtccttaatgttagatcc
gctagtgattcattgcatatctatattggtgctccaaaagagtcgggaagcaagcctgtg
agccaggattatccactcacttatgaaattattttttgggaaaacacttcaaatgctgag
agaaaaattttcaagaataaaactgattttattgttcctaatttgaaaccactgactgta
tattgtgtcaaagccagagctcacgccatggatgaaaagtggaataaaagcagtgctttt
agtgatgtagtgtttgtgaaaacaaaaccaggaaatgcatctaaaatttggtttatagtt
ggaatttgtactgcattatttgctatcccagctctcatttatggtgtgaaagtcctcctg
agatgcatcaattatgtgttctttccatcacttaaaccttcttccaatatagatgagtat
ttctctgaacagtcattgaagaatcttctgctttcaacttctgaagaaaaaattgaaaaa
tgttttataatcgaaaatatatgcacaattgctacagtagaagaaactaatcaaactgat
gaagatcataaacaatacagttcccaaaactgccaggattcgggaaattattctaatgaa
gatgaaagcgaaagtaaaacaagtgaagagctacagcaggattttgtatga

DBGET integrated database retrieval system