KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100411862
Entry
100411862         CDS       T03264                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04022  cGMP-PKG signaling pathway
cjc04141  Protein processing in endoplasmic reticulum
cjc04151  PI3K-Akt signaling pathway
cjc04211  Longevity regulating pathway
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04668  TNF signaling pathway
cjc04728  Dopaminergic synapse
cjc04911  Insulin secretion
cjc04915  Estrogen signaling pathway
cjc04918  Thyroid hormone synthesis
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc04935  Growth hormone synthesis, secretion and action
cjc05020  Prion disease
cjc05030  Cocaine addiction
cjc05031  Amphetamine addiction
cjc05034  Alcoholism
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100411862 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100411862 (ATF6B)
   04022 cGMP-PKG signaling pathway
    100411862 (ATF6B)
   04151 PI3K-Akt signaling pathway
    100411862 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100411862 (ATF6B)
   04915 Estrogen signaling pathway
    100411862 (ATF6B)
   04926 Relaxin signaling pathway
    100411862 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    100411862 (ATF6B)
   04918 Thyroid hormone synthesis
    100411862 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    100411862 (ATF6B)
   04925 Aldosterone synthesis and secretion
    100411862 (ATF6B)
   04927 Cortisol synthesis and secretion
    100411862 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100411862 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100411862 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    100411862 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100411862 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    100411862 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    100411862 (ATF6B)
   05031 Amphetamine addiction
    100411862 (ATF6B)
   05034 Alcoholism
    100411862 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100411862 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100411862 (ATF6B)
   05161 Hepatitis B
    100411862 (ATF6B)
   05163 Human cytomegalovirus infection
    100411862 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100411862 (ATF6B)
Transcription factors [BR:cjc03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100411862 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA Docking
Other DBs
NCBI-GeneID: 100411862
NCBI-ProteinID: XP_008992441
Ensembl: ENSCJAG00000036009
LinkDB
Position
4
AA seq 708 aa
MVGGWGGKMAELMLLSEIADPTRFFTDNLLSPEDWGLRNSTLYSGLDEVAEEQTQLFRCP
EQDVPFDGSSLDVGMDVSPPEPPWELLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTEPS
SQALGVGEVLHVKTESLAPPLCLLGDDPTSSFETVQINVGLTSDDSSDVHTKIEPVSPCS
SINSEASLLSADSSSQAFIGEEVLEVKTESPSPSGCLLWDIPAPSLGAVQISMGPSPDGS
SGKALPTRKPPLQPKPVVLTTIPMPPRTVPPSTTVLLQPLVQPPPVSPVVLIQGAIRVQP
EGPAPSLPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQG
LEARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFG
PVSISEPPSAPISARVNKGEPRPRRHLLEFSGPVHRVEPLQGSSHSPEEPQPSPEDQPRF
RNLTAFPGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRA
QERQKSQPRKSSPVKAVPIQPPGPPERDSVGQLQLYRHPDRSQPAFLDAIDRREDTFYVV
SFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDTRVI
HIKTSTVPPSLRKQPSPTPGNATGGPLPASAASQAHQASHQPLYLNHP
NT seq 2127 nt   +upstreamnt  +downstreamnt
atggttggggggtgggggggaaagatggcggagctgatgctcctcagtgagattgcagac
ccgacgcgtttcttcaccgacaacctgctgagcccggaggactggggtctgcggaacagc
accttgtattctggcctagatgaagtggccgaggaacagacgcagctcttccgttgcccg
gagcaggatgtcccgtttgacggcagttccctggacgtggggatggatgtcagcccccct
gagcccccgtgggaactcctgcccatctttccagatcttcaggtgaagtctgagccatct
tccccctgctcgtcctcctccctcagctcggaatcatcacatctctccacagagccctcc
agccaggctcttggggtaggagaggtgctccatgtgaagacagagtccttggcaccccca
ctctgtctcctgggagatgacccaacatcctcgtttgaaaccgtccagatcaatgtaggc
ctcacctctgatgattcctcagatgtccataccaagatagaacctgtctctccatgttcc
tccatcaactctgaggcctccctgctctcagccgactcctccagccaggcttttatagga
gaggaggtcctggaagtgaagacagagtccccatctccttcagggtgtcttctgtgggat
atcccagccccatcacttggagctgtccagatcagcatgggcccatcccctgatggctcc
tcagggaaagccttgcccacccggaagccgccactgcagcccaaacctgtggtgctaacc
accatcccaatgccacccagaactgtgcctcccagcaccactgttcttctgcagcctctc
gtccagccacccccagtgtccccagttgtcctcatccagggtgctattcgagtccagcct
gaagggccagctccctctcttccacggcctgagaggaagagcattgttcctgctcctatg
cctggaaactcctgccctcctgaagtggatgcaaagctgctgaagcggcagcagcgaatg
atcaagaacagggagtcagcctgccagtcccggagaaagaagaaagagtatttgcagggg
ctggaggctcggctgcaggcggtactggctgacaaccagcagctccgccgggagaatgct
gccctccggcggcggctggaggccctgctggctgaaaacagcgagctcaagttaggatcg
ggaaacaggaaggtggtctgcatcatggtcttccttctcttcatcgccttcaactttgga
cctgtcagcatcagtgagcctccttcagctcccatctctgctcgggtgaacaagggggag
cctcgcccccggagacacttgctggagttctcagggccagttcacagagttgaacctctc
caggggtcctcccatagccctgaggagccccagcctagccccgaagaccagcccagattc
aggaacctgacagccttccctgggggcgccaaggagctactactgagagacctagaccag
ctcttcctctcctctgattgccggcatttcaaccgaaccgagtccctgaggcttgctgac
gagttgagtggctgggtccagcgccaccagagaggccggcggaagatccctcagagggcc
caggagagacagaagtctcagccacggaagtcatctccagttaaggcagtccccatccaa
ccccctggacccccagaaagggattctgtgggccaactgcagctatatcgccacccagac
cgttcacagccagcgttcttggatgcaattgaccgacgggaagacacattctatgttgtc
tctttccgaagggatcacctgctgctcccagccatcagccacaacaagacctcccggccc
aagatgtctctggtgatgcctgctatggcccccaatgagaccttgtcaggccgtggggcc
ccgggggactatgaggagatgatgcagatcgaatgtgaggtcatggacaccagggtgatt
cacatcaagacctccacggtgcccccctcgctccgaaaacagccatcccccaccccaggc
aatgccacaggtggccccttgccagcctctgcagccagccaggcccaccaggcctctcac
cagcccctctacctcaatcatccctga

DBGET integrated database retrieval system