KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100411875
Entry
100411875         CDS       T03264                                 

Gene name
ZBP1
Definition
(RefSeq) Z-DNA binding protein 1
  KO
K12965  Z-DNA binding protein 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04217  Necroptosis
cjc04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100411875 (ZBP1)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    100411875 (ZBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100411875 (ZBP1)
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     100411875 (ZBP1)
   mRNA cycle factors
    Stress granule specific factors
     100411875 (ZBP1)
SSDB
Motif
Pfam: z-alpha RHIM
Other DBs
NCBI-GeneID: 100411875
NCBI-ProteinID: XP_017827618
LinkDB
Position
5
AA seq 338 aa
MAQASADPGKEGHLEQRILKVLMEAGSPVKLSQLVKECQVPKKELNQVLYRMKTELKVSL
TAPATWRLGGASPGGEGPAELAIPSPAKRPLQDIATIPESPGPQFSQREKEIYSFLKDNG
PQRALYIAQGLKMRTAKDVNRDLYRMKSRHLLDLDEQSKTWRIYRPEDSGGTAESTSIIY
QHNPINVICQNGPNGQISIAHSEAIQIGHGNTMTRQAVSREDSESPERAPGGNLNLGEPP
GPPGGGQVWGIQPSRGKGELPHYGHPENEGAWIKVLISLYFDTFDLSFLFLFFDKTLKLR
WGPSVLHLTLCFQWGPMFLHEKQLNYSLPPKNATGRLL
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggcccaggcttctgctgatccaggcaaagaaggccaccttgaacagaggatcctgaag
gtgctgatggaggctggctctccagtgaagctttcccagctggtgaaagaatgccaagtg
cccaagaaggagctcaaccaagtcctctaccgaatgaaaacggagctgaaagtctccctc
acagcccctgccacctggcgcttgggtggggctagtcctggtggcgagggtcctgcagag
ctggccattcccagtcctgccaagaggcccctacaagacatagctacaattccagagagc
cctgggcctcagttcagccaacgagagaaagaaatctacagttttctcaaagacaatggt
ccccaaagggctctgtacatcgcccaggggctgaaaatgaggacagcaaaagatgtgaac
cgagacttgtacaggatgaaaagcaggcaccttctggacttggatgagcaatccaaaaca
tggaggatttaccgcccagaagattctggaggaacagcagagtctacctcgattatttac
cagcacaatccaatcaatgtgatctgccagaatggaccgaacggccagatttccattgca
cactcggaagccatccagattggacacgggaacaccatgacaaggcaggcagtctccagg
gaggacagtgagtcacccgagagagccccgggagggaacctcaacctcggggagccacct
ggtccaccaggtggaggccaagtgtggggtattcagccctccagggggaaaggggagctt
ccacattatggccaccctgagaatgagggcgcctggatcaaagttctgatttccctgtac
tttgataccttcgacctcagtttcttatttttattttttgataaaaccttaaaattaaga
tggggtccctctgtgttgcacttgaccttatgctttcagtggggtccgatgtttctccat
gagaaacaactcaattactctctccctccgaagaatgctacagggaggttattgtag

DBGET integrated database retrieval system