KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412331
Entry
100412331         CDS       T03264                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc04010  MAPK signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04144  Endocytosis
cjc04151  PI3K-Akt signaling pathway
cjc04510  Focal adhesion
cjc04540  Gap junction
cjc04630  JAK-STAT signaling pathway
cjc04810  Regulation of actin cytoskeleton
cjc05163  Human cytomegalovirus infection
cjc05200  Pathways in cancer
cjc05206  MicroRNAs in cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05218  Melanoma
cjc05230  Central carbon metabolism in cancer
cjc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100412331 (PDGFRA)
   04014 Ras signaling pathway
    100412331 (PDGFRA)
   04015 Rap1 signaling pathway
    100412331 (PDGFRA)
   04630 JAK-STAT signaling pathway
    100412331 (PDGFRA)
   04020 Calcium signaling pathway
    100412331 (PDGFRA)
   04072 Phospholipase D signaling pathway
    100412331 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    100412331 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100412331 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100412331 (PDGFRA)
   04540 Gap junction
    100412331 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100412331 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100412331 (PDGFRA)
   05206 MicroRNAs in cancer
    100412331 (PDGFRA)
   05230 Central carbon metabolism in cancer
    100412331 (PDGFRA)
   05231 Choline metabolism in cancer
    100412331 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    100412331 (PDGFRA)
   05218 Melanoma
    100412331 (PDGFRA)
   05215 Prostate cancer
    100412331 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100412331 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100412331 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100412331 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cjc04090]
    100412331 (PDGFRA)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100412331 (PDGFRA)
Protein kinases [BR:cjc01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100412331 (PDGFRA)
CD molecules [BR:cjc04090]
 Proteins
  100412331 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 100412331
NCBI-ProteinID: NP_001257517
Ensembl: ENSCJAG00000018415
UniProt: F6VUA7
LinkDB
Position
3
AA seq 1089 aa
MGTSHPVFLVLGCLLTGLSLILCQLSLPSVLPNENEKVVQLNSSFSLRCFGESEVSWQYP
MSEEENPNVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNG
TFTVGPYICEATVEGKKFQTIPFNVYALKATSKLDLEMEALKTVYKSGETIVVTCAVFNN
EVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATREVK
EMKKVTISVHEKGFIEIKPNFSQLEAVNLHEVKNFVVEVQAYPTPRISWLKNNLTLIENL
TEITTDVEKIQETRYRSQLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSTGGQTVRCMAEGTPLPDIEWMICKDIKKCNNETSWTILANNVSNIITEVHPRG
RSTVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKAKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccatccggtgttcctggtcctaggctgtcttcttacagggctgagccta
atcctctgccagctttcattaccctctgtccttccaaatgaaaatgaaaaggttgtgcag
ctgaattcatccttttctctgagatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagaaccccaatgtggaaatcagaaatgaggaaaacaacagtggcctt
tttgtgacggtcttggaagtgagcagcgcctcggcagcccacacagggctgtacacttgc
tattacaaccacactcagacagaagagaatgagcttgaaggcaggcacatttacatctat
gtgccagacccagatgttgcctttgtacctctaggaatgacggattatttagtcattgtg
gaggacgatgattctgccatcataccttgtcgcaccactgatcccgagactcctgtaacc
ttacacaacagtgagggggtggtacctgcctcctatgacagcagacagggctttaatggg
accttcactgtcgggccctatatctgtgaggccactgtcgaagggaaaaagttccagacc
atcccttttaacgtttatgctttaaaagcaacatcaaagctggatctagaaatggaagct
cttaaaaccgtgtataagtcaggggaaacgattgtagtcacctgtgctgtatttaataat
gaggtggttgaccttcagtggacttaccctggagaagtgaaaggcaaaggcatcacaatg
cttgaagaaatcaaagtcccatccatcaaattggtgtacactttgacggtccccgaggcc
acggtgaaagacagtggagattacgaatgtgctgcccgccaggctaccagggaggtcaaa
gaaatgaagaaagtcactatttctgtccatgagaaaggcttcattgagatcaaacccaac
ttcagccagttggaagctgtcaacctgcatgaagtcaaaaattttgtcgtagaggtgcag
gcctacccaactcccaggatatcctggctgaaaaacaacctgactctgattgaaaatctc
accgagatcaccactgatgtagaaaagattcaggaaacaaggtatcgaagccaattaaag
ctaatccgtgctaaggaagaagacagtggccattacactattgtagttcaaaatgaagat
gatgtgaagagctatacttttgaactgttaactcaagttccttcatccattctggacttg
gttgatgatcaccatggctcaactgggggacaaactgtgaggtgcatggctgaaggcacg
ccgcttcctgatattgagtggatgatttgcaaggatattaagaaatgtaataacgaaact
tcctggacaattttggccaacaatgtctcaaacatcatcacggaggtccatccccgaggc
aggagtactgtggagggccgtgtgactttcgccaaggtggaggagaccattgcggtgcga
tgcctggctaagaatctccttggtgctgagaaccgagagctgaagctcgtagctcccacc
ctgcgttctgaactcacggtggctgccgcggtcctggtgctgttggtgattgtgatcatc
tcactcattgttctggtcgtcatttggaaacagaaaccgaggtatgaaattcgctggagg
gtcattgaatcaatcagccctgatggacatgaatatatttacgtggacccgatgcagctg
ccttatgactcaagatgggagtttccaagagatggactagtgcttggtcgggtgttgggg
tctggagcgtttgggaaggtggttgaaggaacagcctatggattaagccgatcccagccg
gtcatgaaggttgccgtgaagatgttaaagcccacggccagatccagtgaaaaacaagct
ctcatgtctgaactgaagataatgactcacctggggccacacttgaacattgtaaacttg
ctgggagcctgtaccaagtcaggccccatctacatcatcacagagtactgcttctatgga
gatttggtaaactatttgcataagaatagggatagcttcctgagccaccacccggagaag
gcaaagaaagaactggatatctttggattgaaccctgctgatgaaagcacacggagctat
gttattttgtcttttgaaaacaatggtgactacatggacatgaagcaagctgatactaca
cagtatgtccccatgctggaaaggaaagaagtttctaaatattccgacatccagagatca
ctctatgatcgtccagcctcatataagaagaaatctatgttagactcagaagtcaaaaac
ctcctttcagatgataactctgaaggcctcactttgttggatttgttgagcttcacctat
caagttgcccgaggaatggagtttttggcttcaaaaaattgtgtccaccgggatctggct
gctcgcaacgtcctcctggcacaaggaaaaattgtgaagatctgtgacttcggcctggcc
agagacatcatgcatgactcgaactacgtgtcaaaaggcagtacctttctgcctgtgaag
tggatggctcctgagagcatctttgacaacctctacaccacactgagtgacgtctggtct
tatggcattctgctctgggagatcttttcccttggtggcaccccttaccccggcatgatg
gtggattctactttctataataagatcaagagtgggtaccggatggccaagcctgaccac
gctaccagtgaagtctacgagatcatggtgaaatgctggaacagcgagccggagaagaga
ccctccttttaccacctgagtgagattgtggagaatctgctgcctggacaatataaaaag
agttatgaaaaaattcacctggacttcctgaagagtgaccatcctgccgtggcacgcatg
cgtgtggactcagacaatgcgtacattggtgtcacctacaaaaacgaggaagataagctg
aaggactgggagggtggcctggatgagcagaggctgagcgctgacagtggctacatcatt
cctctgcctgacatcgaccctgtccctgaggaggaggacctgggcaagaggaacagacac
agctcacagacctctgaagagagtgccattgagacaggttccagcagttcgaccttcatc
aagagagaggatgagaccatcgaagacatcgacatgatggacgacatcggcatagactct
tcagacctggtggaagacagcttcctgtaa

DBGET integrated database retrieval system