KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100412880
Entry
100412880         CDS       T03264                                 

Gene name
BAD
Definition
(RefSeq) BCL2 associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc01524  Platinum drug resistance
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04140  Autophagy - animal
cjc04151  PI3K-Akt signaling pathway
cjc04210  Apoptosis
cjc04370  VEGF signaling pathway
cjc04510  Focal adhesion
cjc04722  Neurotrophin signaling pathway
cjc04910  Insulin signaling pathway
cjc04919  Thyroid hormone signaling pathway
cjc05010  Alzheimer disease
cjc05014  Amyotrophic lateral sclerosis
cjc05020  Prion disease
cjc05022  Pathways of neurodegeneration - multiple diseases
cjc05145  Toxoplasmosis
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05165  Human papillomavirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05203  Viral carcinogenesis
cjc05210  Colorectal cancer
cjc05211  Renal cell carcinoma
cjc05212  Pancreatic cancer
cjc05213  Endometrial cancer
cjc05215  Prostate cancer
cjc05218  Melanoma
cjc05220  Chronic myeloid leukemia
cjc05221  Acute myeloid leukemia
cjc05223  Non-small cell lung cancer
cjc05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100412880 (BAD)
   04014 Ras signaling pathway
    100412880 (BAD)
   04370 VEGF signaling pathway
    100412880 (BAD)
   04024 cAMP signaling pathway
    100412880 (BAD)
   04022 cGMP-PKG signaling pathway
    100412880 (BAD)
   04151 PI3K-Akt signaling pathway
    100412880 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100412880 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    100412880 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100412880 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100412880 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100412880 (BAD)
   04919 Thyroid hormone signaling pathway
    100412880 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100412880 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100412880 (BAD)
   05203 Viral carcinogenesis
    100412880 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100412880 (BAD)
   05212 Pancreatic cancer
    100412880 (BAD)
   05225 Hepatocellular carcinoma
    100412880 (BAD)
   05221 Acute myeloid leukemia
    100412880 (BAD)
   05220 Chronic myeloid leukemia
    100412880 (BAD)
   05218 Melanoma
    100412880 (BAD)
   05211 Renal cell carcinoma
    100412880 (BAD)
   05215 Prostate cancer
    100412880 (BAD)
   05213 Endometrial cancer
    100412880 (BAD)
   05223 Non-small cell lung cancer
    100412880 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100412880 (BAD)
   05014 Amyotrophic lateral sclerosis
    100412880 (BAD)
   05020 Prion disease
    100412880 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    100412880 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100412880 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100412880 (BAD)
   05161 Hepatitis B
    100412880 (BAD)
   05160 Hepatitis C
    100412880 (BAD)
   05162 Measles
    100412880 (BAD)
   05168 Herpes simplex virus 1 infection
    100412880 (BAD)
   05165 Human papillomavirus infection
    100412880 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100412880 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100412880 (BAD)
   01524 Platinum drug resistance
    100412880 (BAD)
   01522 Endocrine resistance
    100412880 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 100412880
NCBI-ProteinID: XP_002755519
Ensembl: ENSCJAG00000018074
UniProt: U3F2S3
LinkDB
Position
11
AA seq 167 aa
MFQIPEFEPSEQEDSSSAERGLSPSTAGDRPPGSGKHRRQAPGLPGDASHQQGQSTSSSH
HGGAGAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
FVDSFKGLPRPKSAGTATQMRQSSSWTRVIQSWWDRNLGRGGSAPSQ
NT seq 504 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagccgagtgagcaggaagactccagctctgcagagagg
ggcctgagccccagcaccgcaggggacaggcccccaggctctggcaagcatcgacgccag
gccccaggcctcccgggggacgccagtcaccagcagggacagtcaaccagcagcagccac
catggaggcgctggggctgtggagacccggagtcgccacagctcgtaccccgcagggacg
gaggaggacgaagggatggaggaggagcccagcccctttcggggccgttcgcgctcggca
ccccccaacctctgggcagcacagcgctatggccgcgagctccggaggatgagtgatgag
tttgtggactcctttaagggacttcctcgcccgaagagcgcgggcacagcaacgcagatg
cggcaaagctccagctggacgcgagtcatccagtcctggtgggataggaacttgggcagg
ggaggctccgctccttcccagtga

DBGET integrated database retrieval system