KEGG   Coturnix japonica (Japanese quail): 107321839Help
Entry
107321839         CDS       T04297                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00590  Arachidonic acid metabolism
cjo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107321839 (PTGS1)
Enzymes [BR:cjo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     107321839 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 107321839
NCBI-ProteinID: XP_015734704
LinkDB All DBs
Position
17
AA seq 607 aa AA seqDB search
MGGGCRDRAHLAALRLLVAHAMLLCAAGSAAAAGTVNPCCYYPCQHQGVCVRIGLEGYEC
DCTRTGYFGANCTSPELWTRLRDLLKPSPAFYHFVLTHFGWFWDIINSTFIRDTLMRLVL
TVRANLIPSPPTFNSQYGYISWEAYANVSYYTRILPPVPKECPTPMGTKGKQQLPDAQLL
AQRFLLRHKFEADPRGTNLMFAFFAQHFTHQFFKTSGKMGRGFTKALGHGVDLGHLYGDN
LQRQHQLRLFQDGKLKFQVVNGEVYPPSVTEVPVHMVYPPAIPKEKQLAMGQEVFGLLPG
LCMYATLWLREHNRVCDILKQEHPTWDDEQLFQTARLILIGETIKIVIEDYVQHLSGYFL
SLKFDPELLFEQQFQYRNRIAVEFNQLYHWHGLMPDSFTIQGQEYSYKQFLYNTSMLMDY
GVEALVESFSKQTAGRIGGGQNINANVLGVAVGVIEESRQLRLQPFNEYRKRFGLKPYTS
FQELTGEEEKAAELEELYGDIDALEFYPGLLLEKPQPNGIFGESMVEIGAPFSLKGLLGN
PICSPEYWKPSTFGGATGFEIVKTATLEKLVCLNVKKCPYVSFRVPDAAAGGETDSSRAG
GASSTEL
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgggcggtgggtgccgggaccgggcccacctggccgcgctgcggcttctcgtcgcccac
gcgatgctgctctgcgcagccgggagcgccgcggccgccggcaccgtcaacccgtgctgc
tattacccctgccagcaccaaggtgtgtgtgtgcgcatcggcctggaaggctacgagtgt
gactgcacgcggacggggtacttcggggccaactgcacctcacctgagctctggacgcgc
ctacgtgacctgctgaagcccagtcctgccttctaccactttgtcctcacccacttcggg
tggttctgggacatcatcaacagcacattcatcagagacacactgatgaggctcgtgctt
acagttcgcgccaacctcatccccagccctcccaccttcaactcccaatacggctacatc
agctgggaggcctacgccaatgtcagctattacacccgcatcctcccaccagtgccaaag
gaatgccccacgcccatggggaccaaagggaagcagcagctccccgatgctcagctgctg
gctcagcgcttcctgctgcggcacaaatttgaagctgatccccggggcaccaacttgatg
ttcgccttctttgcccagcatttcacccaccagttcttcaagacctctgggaagatggga
cgtggtttcaccaaggcactggggcacggggtggacctggggcacctctatggggacaac
ctgcagcggcagcaccagctgcgtctctttcaagatgggaagctcaaattccaggtggtg
aatggggaggtttacccaccgtccgtcactgaggtgccggtgcacatggtctatccgcct
gccatccccaaagagaagcagctggcaatggggcaggaggtgttcgggctgctgccgggg
ctctgcatgtacgccacgctctggctgcgtgagcacaaccgcgtctgtgacatcctgaag
caggagcatcccacctgggatgacgagcagctcttccagacagcacggctcatcctcatc
ggggagaccatcaagattgtcattgaggactatgtgcagcacctcagcgggtacttcctg
agcctcaagtttgaccctgagctgctgtttgagcagcagttccagtaccggaatcgcatt
gcggtggagttcaaccagctctaccactggcacgggctgatgcccgactccttcaccatc
cagggacaggagtacagctacaagcagttcctctacaacacctccatgctcatggactat
ggcgtggaggccctggtggagtccttttccaagcagactgcaggaaggatcggtgggggg
caaaacatcaatgccaacgtattgggagtggctgttggagtcatcgaggagtcgcggcag
ctgaggctgcagcccttcaatgagtatcggaagaggtttggcctgaagccctacacgtcc
ttccaggagctcacaggagaggaggagaaggcagcagagctggaggagctgtatggggac
atcgatgctctggagttttatccaggactgctgcttgagaaaccccaacccaacggcatc
tttggggaaagcatggtggagattggcgctccattttcactgaagggacttcttgggaac
cccatctgctccccagagtactggaagcccagtacctttggtggagcaaccggcttcgag
atcgtcaagacggcaacactggagaaactcgtgtgcctcaatgtgaagaagtgtccatac
gtgtcattccgtgtgccagatgctgcggcaggaggtgagaccgacagtagccgtgcgggt
ggagcatcatccacagagctgtag

DBGET integrated database retrieval system