KEGG   Citrobacter koseri: CKO_01647Help
Entry
CKO_01647         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cko  Citrobacter koseri
Pathway
cko00480  Glutathione metabolism
cko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cko00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CKO_01647
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cko02000]
    CKO_01647
Enzymes [BR:cko01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CKO_01647
Transporters [BR:cko02000]
 Other transporters
  Pores ion channels [TC:1]
   CKO_01647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N_2 GST_N GST_N_3 GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ABV12779
UniProt: A8AH16
LinkDB All DBs
Position
1586305..1586955
Genome map
AA seq 216 aa AA seqDB search
MPHYHTLNLSKKELPMKLFYKPGACSLASHITLRESGIDFTLDGVDLAKKRLENGDDYFA
VNPKGQVPALLLDDGTLLTEGVAIMQYLADSVPDRQLLAPTGTISRYKTLEWLNYIATEL
HKGFTPLFRPDTPEEYKPIVRTQLEKKLHYVNDALQEGQCLCGQRFTIADAYLFTVLRWA
KAVKLNMEGLSHIDVYMARVAERPCVAAALKAEGLN
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgccgcactaccatacgttaaacctcagcaaaaaggagttaccgatgaaactgttctac
aaaccgggcgcctgttctcttgcttctcacatcaccctgcgggaaagcggtattgacttc
acgctggatggcgttgatctggcgaaaaagcgtctggaaaacggcgatgattatttcgcg
gtaaacccaaaaggacaggttccggctctgctgctggacgatggcaccttactgaccgaa
ggcgttgcgattatgcaatatctggcagatagcgtgcccgatcgtcagctgttggcaccg
acaggcaccatctcccgctacaaaacgctggaatggctcaactatattgccacggagctg
cacaaaggttttacgccactcttccgcccggatacgccagaggaatataaaccgattgtc
cgtacgcagctggagaaaaaattgcactacgtgaatgatgcgctccaggaaggccagtgt
ctttgcggccagcgtttcacgatcgcagatgcctacctttttaccgtgttgcgttgggcg
aaagcggtgaagctgaatatggaaggattaagccatatcgacgtttatatggcgcgggtc
gctgaacgcccctgcgtggcggcggcgctgaaggcggaaggtttgaactaa

DBGET integrated database retrieval system