KEGG   Citrobacter koseri: CKO_02552Help
Entry
CKO_02552         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cko  Citrobacter koseri
Brite
KEGG Orthology (KO) [BR:cko00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CKO_02552
Enzymes [BR:cko01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CKO_02552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_2 NAD_binding_8 Thi4 FAD_binding_3 K_oxygenase AlaDh_PNT_C FMO-like DAO Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ABV13661
UniProt: A8AJJ7
LinkDB All DBs
Position
complement(2354099..2355664)
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTRPVELIATLDDSAKSAEIKELLAEIAELSEKVTFKEDNSLPV
RKPSFLIANPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVYLNGNE
FGQGRMTLTEIVAKVDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVDDYDVDVIDSQSASKLLPAATEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GSKVTGLEYRDRVSGDIHNVALSGIFVQIGLLPNTNWLEGAIERNRMGEIIIDGRCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRSKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacactaacatgaaaactcagctcaaagcgtatcttgagaaactgaccaggcct
gttgagctgattgccacgctggacgacagcgctaaatcggcagaaatcaaggaattgctg
gctgaaatcgctgaactgtcagagaaagtcacatttaaagaagataacagcctgccggtg
cgcaagccttctttcttgatagcaaacccgggttctgaccaggggccgcgctttgcgggt
tctccgctggggcatgaatttacctcgctggtgctggcgctgttgtggactggcggccat
ccgtcgaaagaggcgcagtctctgctggagcagatccgcgatatcgacggcgatttcgag
tttgaaacttattactcgctctcctgccacaactgccctgacgtcgtacaggcgctgaac
ctgatggcggtgctgaacccgcgtatcaaacataccgcgattgacggcggcacattccag
aatgaaatcaccgatcgtaatgtgatgggcgttccggctgtgtacctgaacggtaacgaa
ttcggtcagggacgtatgacgctgacggaaatcgtcgccaaagtggataccggcgcagaa
aaacgggcggcggaagagctgaataagcgtgacgcttacgacgtactgattgtcggttcc
ggcccggcgggggcggcagcggcagtttactccgcacgtaaaggcattcgtaccggtctg
atgggcgagcgttttggcggtcaggtgctggataccgttgatatcgagaactatatttcc
gtgccaaaaacggaagggcagaagctggctggcgcgctgaaagcgcacgttgatgattac
gatgttgacgtgatcgacagccagagcgcgagcaaactgcttccggcggcaacggaaggg
ggcctgcatcagattgagaccgcttccggcgcggtgctgaaagcccgcagcattatcatt
gccaccggtgccaaatggcgcaacatgaacgtgccgggcgaagatcagtaccgcacgaaa
ggcgtaacctattgcccgcactgcgacggcccgctgtttaaaggcaaacgcgttgcggta
atcggcggggggaactccggcgtggaagcggcgattgacctcgcggggatcgttgagcac
gttacgctgctggaatttgcgccagaaatgaaagccgaccaggttctgcaagataaagtg
cgtagcctgaaaaacgtcgacattattctgaacgcgcagacaacggaagtgaaaggcgac
ggcagtaaagtgacggggctggaatatcgcgatcgcgtaagcggcgacatccacaacgtt
gcgctgtccgggatcttcgtacagattggcttgctgccaaacaccaactggctggaaggc
gcgattgagcgtaaccgtatgggcgaaatcatcattgatggccggtgcgaaaccagcgtg
aagggcgtattcgccgcaggcgactgcaccacggttccttacaaacagatcatcatcgcg
acgggcgaaggcgcgaaagcctctctgagcgcatttgattatctgatccgcagtaagacg
gcataa

DBGET integrated database retrieval system