KEGG   Cimex lectularius (bed bug): 106661787Help
Entry
106661787         CDS       T05603                                 

Definition
(RefSeq) potassium voltage-gated channel subfamily KQT member 1
  KO
K04926  potassium voltage-gated channel KQT-like subfamily member 1
Organism
clec  Cimex lectularius (bed bug)
Brite
KEGG Orthology (KO) [BR:clec00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:clec04040]
    106661787
Ion channels [BR:clec04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   106661787
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: KCNQ_channel Ion_trans Ion_trans_2 RCS1 CD225 IQ DUF4149
Motif
Other DBs
NCBI-GeneID: 106661787
NCBI-ProteinID: XP_024084446
LinkDB All DBs
Position
Unknown
AA seq 503 aa AA seqDB search
MVVLVCLIFSVLSTIEAYSNFANKTLFWMEIWLVVFFGVEYIVRLWSAGCRSKYMGCCGR
FRFVRKPICIIDLIVVVASIVVLTVGSNGQVFATSAIRGIRFLQILRMLHVDRQGGTWRL
LGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVGPDGKTDFSNYADALWWGVITV
TTIGYGDAVPHTWMGKIVASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPA
AAMLIQCLWRCYAADKSFKGNATWNIYVKDMSNSKEAPPPTKSLMLQVAKKASVLKRRKS
KNKMEPPPSTANTPGSMECNNTMRRDSEGEVVFYIEEPKAGTPNRIRRDGNTFRGLVSQT
SSVTEVASDDMDLDLEPERITELTEVHKNAIRAIRKIKYFVARRKFQQARKPYDVRDVIE
QYSQGHLNMMVRIKELQRRLDQTLGKPGSYLGGIDRAGNIKPMTIGARLCRVEQQLSNMD
RKLDQLMYVLNTQAHKHTIEEQV
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggttgtgcttgtgtgcctgatattcagtgtgctgtccacaatagaagcgtattcgaat
ttcgcaaataaaacattattttggatggaaatatggctcgttgtttttttcggcgtggag
tacatcgtgaggttatggtcggctggatgcaggtcgaagtacatgggatgctgcgggcgt
tttagattcgttagaaaaccgatttgtattattgatctcatagttgtagtcgcttcgata
gtcgtcctgacagtaggctccaatggccaagtgttcgccacttcggcaatccggggtatc
cgtttcctccagattctacggatgcttcacgtcgatcgacagggcggcacctggcgactc
cttggttctgtagtttttatccatagacaggaattgataacaacactttacatcgggttt
ttagggttgattttcagtagctattttgtttatttggctgagaaagacgcggtcggccca
gatggaaaaacggatttttccaattacgccgatgcactgtggtggggagtgataacagta
acaacgattggatacggggacgcagtaccacacacgtggatgggcaaaatcgtggcgtct
tgtttcagcgtctttgcaatatcgtttttcgccttgcccgctggtatcctgggttcgggg
ttcgcactcaaagtccagcagaaacagaggcaaaagcatttcaacaggcagatccctgcg
gcagcaatgctaatccaatgtctttggaggtgttacgccgccgacaaatcctttaaggga
aacgcgacctggaacatttatgtaaaagacatgtccaattccaaagaggcaccaccaccg
acaaagtcgctcatgcttcaagttgcaaaaaaagccagcgtcctaaaaagaagaaagtcc
aaaaacaaaatggagccgccgccctcgacggcaaacacaccgggctcaatggaatgcaac
aacaccatgagaagggacagcgaaggagaagtcgtcttttacatcgaagagccgaaagcc
ggaactccaaacagaatcagaagagacggcaacacgtttcgagggcttgtcagtcaaacg
agcagcgttacggaggtcgcgagtgacgacatggatctggacttggagccagaacgaatt
accgagttgaccgaagtgcacaaaaacgctatccgggctatcagaaaaatcaaatacttc
gtcgcacggagaaaattccagcaggccaggaagccgtacgacgtgcgggacgttatcgag
cagtacagccaaggccatttaaacatgatggtccgaataaaggaattgcaaaggcgactg
gatcagactttagggaagccgggaagctatttaggaggaatcgatagagcgggaaacatc
aaaccgatgacaataggtgcacggctttgccgcgtagagcaacagttgtcgaacatggac
agaaagctcgatcaactgatgtacgtgctgaacactcaagctcacaagcacaccatcgaa
gaacaggtgtga

DBGET integrated database retrieval system