KEGG   Clostridium ljungdahlii: CLJU_c05320
Entry
CLJU_c05320       CDS       T01276                                 

Gene name
rfbB1
Definition
(GenBank) dTDP glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
clj  Clostridium ljungdahlii
Pathway
clj00521  Streptomycin biosynthesis
clj00523  Polyketide sugar unit biosynthesis
clj00525  Acarbose and validamycin biosynthesis
clj01055  Biosynthesis of vancomycin group antibiotics
clj01100  Metabolic pathways
clj01110  Biosynthesis of secondary metabolites
Module
clj_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:clj00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CLJU_c05320 (rfbB1)
   01055 Biosynthesis of vancomycin group antibiotics
    CLJU_c05320 (rfbB1)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CLJU_c05320 (rfbB1)
   00525 Acarbose and validamycin biosynthesis
    CLJU_c05320 (rfbB1)
Enzymes [BR:clj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     CLJU_c05320 (rfbB1)
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD Polysacc_synt_2 NAD_binding_4 RmlD_sub_bind adh_short KR NmrA Sacchrp_dh_NADP NAD_binding_10
Other DBs
NCBI-ProteinID: ADK13614
UniProt: D8GMK4
LinkDB
Position
577934..578989
AA seq 351 aa
MKTYLVTGGAGFIGSNFIHYMLKKYSDIKIINYDKLTYAGNLENLKSISKNSNYIFIQGD
ICDREKLQQLFQKYDIDYVINFAAESHVDRSIRDPEVFVKTNVLGTVALLDTAKNAWTVE
DGFKEGKKYLQVSTDEVYGSLGKEGYFTEKTPLDSHSPYSSSKASADLMVKAYFDTYKMP
VNITRCSNNYGAYQFPEKLIPLVINNCLNKRDIPVYGDGLNIRDWLYVEDHCKAIDMVIN
SGQCGEVYNIGGHNERTNIHIVKTIISYIHDNVDSSVGENLIKYVEDRKGHDRRYGIDPT
KIKDELGWYPETKFEDGIVKTIKWYLDNKDWMDNVTSGDYKKYYEKMYKNK
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgaaaacatatttagtaacgggaggagcaggctttattggctccaactttattcactat
atgcttaaaaagtattcagatataaaaataataaactatgacaagctaacctatgcaggt
aatcttgaaaacttaaaatctatatctaaaaactctaactatatcttcattcaaggagac
atatgtgacagggaaaaacttcaacagctatttcaaaaatatgatatagattatgtaata
aattttgcagcagaatctcatgtagacaggagcataagagatcctgaagtatttgtaaaa
acaaatgttctaggtactgtggcacttttagatactgctaaaaatgcgtggactgtagaa
gatggttttaaagaaggtaaaaaatatcttcaggtttctacagatgaagtctatggttcc
cttgggaaagaaggatattttacggaaaaaacccctcttgattctcacagcccttattct
tcaagcaaagcttctgctgatttgatggtaaaggcatatttcgacacctataaaatgcct
gtaaatataaccaggtgctccaataactatggtgcctatcaattcccagaaaaactcatt
ccccttgttataaataactgcttaaataaaagagatattcccgtgtacggtgatggactt
aacataagagattggctttatgtagaagatcactgcaaagctatagacatggttataaat
agtggccagtgcggtgaagtttataacataggcggacataatgagagaacaaacattcat
atagttaaaacaataatttcatatatacatgacaatgtagattcttctgtaggtgaaaat
cttataaagtatgtagaagatagaaaaggacatgacaggagatatggcattgatcctaca
aagattaaggatgaacttggttggtatcctgaaactaaatttgaagatggtatagtgaaa
actataaagtggtatttggataataaagattggatggataatgtaacctctggagattat
aagaaatactatgagaaaatgtataaaaacaaataa

DBGET integrated database retrieval system