KEGG   Clavispora lusitaniae ATCC 42720: CLUG_03488Help
Entry
CLUG_03488        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
Organism
clu  Clavispora lusitaniae ATCC 42720
SSDB OrthologParalogGFIT
Motif
Pfam: ApbA_C DUF3552 EzrA Jnk-SapK_ap_N NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 8496744
NCBI-ProteinID: XP_002616247
UniProt: C4Y5Q4
LinkDB All DBs
AA seq 893 aa AA seqDB search
MGPGIFIHVSGYAVPAPLAPCRYTNGAVGQNPNLAFYAWRLQNTRSCSVTMVDPSLDPSQ
PLIWDSSSFSASEFVPDKLVPSVDHLESSAKYDFVIVSVSTLQSFQDVCSSLVPHVRDET
LIIVESTGCVNLEPFVSLSFPKFKDMPICSIMNESNIKRVPGSSTFIHHIANSDHRIYLG
TCSSDDSKSGNFVSSFTRLYKLLQMVQEDSNGHISLLKSNNAQEFMTYQWKLALPRIVLN
PLSILFEEPSPEKLHAQILAKPLISGLVNEIFKIIKKMKCKLVKGFENEANLVSNWSAIY
PASAPESSVPYSNANSLFYKFYHRQEIDIDLLLLQPILLGDDHGVRTPYLENLYSVMCQY
LKVNTNNSSLFFVRNIPGQEKARREIDNVADELSHLRLEKEKYDASIHERQTQLQQLESS
LSQKKHALSSLLQEIDMQTRNHEHKMKMFSDTEIQHQQQLAEIQNRCSAKQAELAKLSEN
KQTLSANEQPVIPADYNQQREVAPIKSQVVTVKQQENKNGNPTTPDLSDFAHVAVYGAEL
NGEHPSKPQVSAPPEQMPQVQNKEMELQRREQALLERERELEQKSIQSQPPMQREESYFQ
NGGPPMGDGYQNGPPLNVAYNGSNTSYNGSYNGSFNGPYGGPNPNGPMYNGPGNYRPSHS
LTSASANHGYYEGYDQRPPHGLPANGMVQGSMPAALRNPQKYPPSPVQVPPAQRQRMSSY
PTSGHPNAQFQQPQFAQQQVSNGPIVGHGSGQFNNYPKKQNRRSAFPDQALNIDYGGRGG
MPMPTSSQNAAKSKHRSTLPGQMPSPPLPQQRKSNTQVPSSSSGIPSHLRPPQEGTKPGP
SGSNEEIGKSANGSANQDITIEVPQAEIAPKPLGSIAPATTEKKKKRGLFRKS
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atgggccctggcatatttatacatgtgtctggttatgcggtcccagcccctttggctcct
tgtcgatatactaacggtgcagttgggcaaaacccaaatttggccttctatgcttggcgc
ctccaaaacactcgctcatgttcggtgaccatggtcgatccgtctcttgatccgtcgcag
cccctcatatgggactcgctgctgttctccgcttcggagttcgttccggacaagttggtt
ccatccgtggaccacctcgagtcgtctgcgaaatatgactttgtcatagtcagtgtctcc
actctacagagcttccaagacgtctgctcgctgctagtgccgcatgtacgtgacgaaacg
ctcatcatagtggaatccaccggctgcgttaacctcgagccctttgtgctgttgagtttc
cccaaattcaaggacatgcccatctgttccattatgaacgaatcaaacatcaagagggtg
cccggatccagcacatttatccaccacattgcaaattcggaccacagaatatacttggga
acgtgttcatccgacgattccaaatccggcaactttgtcctgctgttcactagactctac
aagttgttgcaaatggtacaagaagactccaatggccacatcagcttgctaaaatccaac
aatgcccaagagttcatgacttaccagtggaaacttgcgttgccgcgtattgttttgaac
ccattgtcgattctttttgaggaaccttcgccggagaaattgcacgcccagattttggca
aagccattgatctctggcttggttaatgagattttcaaaatcattaaaaaaatgaagtgc
aaactcgttaaaggctttgagaacgaagctaatttggttctgaattggctggctatctat
cccgcctccgctccggaactgtctgttccttatctgaatgctaacctgttattctacaaa
ttctaccataggcaggaaattgatattgacttattattgttgcagccaattcttttgggt
gatgaccatggtgtgcggacgccgtatttggaaaacttgtattctgtcatgtgtcagtac
ttgaaagtcaacaccaacaactcgtcgcttttttttgtgcggaacatacctggacaagaa
aaggccagacgggaaatcgacaatgtcgcagacgaattatctcatctcaggttggaaaag
gaaaaatatgatgcaagtatacatgagcggcaaacccagcttcaacagcttgagtcatca
ttatcccaaaagaaacatgcgctttcatccctcttacaagaaattgacatgcaaacgcgt
aatcatgagcacaagatgaaaatgttttcagacactgaaattcagcaccaacagcaatta
gcagaaattcaaaaccgctgcagtgctaaacaagccgagttggctaagctctctgagaac
aaacaaactttaagcgcaaatgaacagccggttattcccgcggactataatcagcagagg
gaagtggcgccaatcaaaagtcaagtggtcactgttaagcagcaagaaaacaaaaatgga
aacccaacgacaccagatttgtcagactttgcccatgttgctgtctacggtgcagaactt
aatggtgagcatccaagcaagccacaagttctggcaccaccagagcaaatgccccaagtt
caaaacaaggaaatggaacttcaacgccgtgaacaggcgcttcttgagcgtgaacgtgag
ctcgagcagaagagcatccaatctcaacctcctatgcagcgcgaagaactgtactttcag
aatggtgggcctcctatgggcgacggttaccagaatggacctccgttgaacgtagcgtac
aatggttccaatacttcctacaacggatcttacaatggttccttcaacggaccatatggc
ggaccgaatcccaacggcccgatgtataatgggcctgggaactatcgtccttcacattct
cttacaagtgcaagcgccaaccacggatattatgaaggatacgaccagcggcctccacat
ggcttgccagcgaacggcatggtgcagggctccatgcctgctgcattgcggaatccccag
aagtatccaccttcgccagttcaagttcctcctgcccagcgccagcgcatgagctcgtat
cctacgctgggccaccccaatgcgcaatttcaacaaccgcaatttgctcagcaacaggtg
tctaatggtcctatcgtgggacatggctcggggcaattcaacaattatccgaagaaacaa
aataggcgttcggcgttccccgatcaagccttgaatattgattacggtggacgcggagga
atgcctatgccaacgtcgtcccaaaatgcggcaaaatccaaacacagatctactttgcct
ggtcagatgccgtcgccaccattgccgcaacaaagaaagtctaatacacaagtgccaagt
tcctcttcgggtatcccgagccatctccggccaccacaagagggaacaaagccaggacct
tcgggatctaatgaagagattggtaaatctgcaaatggcagtgccaatcaggatataacc
atcgaagttccccaggccgaaatcgcaccaaagcctttgggaagcattgctcctgcaacg
acagaaaagaaaaaaaagagagggcttttcagaaaatcttag

DBGET integrated database retrieval system