KEGG   Columba livia (rock pigeon): 102086291
Entry
102086291         CDS       T02912                                 

Gene name
NOS2
Definition
(RefSeq) LOW QUALITY PROTEIN: nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00220  Arginine biosynthesis
clv00330  Arginine and proline metabolism
clv01100  Metabolic pathways
clv04020  Calcium signaling pathway
clv04146  Peroxisome
clv04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    102086291 (NOS2)
   00330 Arginine and proline metabolism
    102086291 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102086291 (NOS2)
   04020 Calcium signaling pathway
    102086291 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102086291 (NOS2)
Enzymes [BR:clv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     102086291 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 102086291
NCBI-ProteinID: XP_013222694
LinkDB
Position
Unknown
AA seq 1146 aa
MMCPWQFVFKPRAAKNRFSEEQDINNNVEKHWTIHGLENDDTKLCDVDKKQTEMPPAPSS
AKAGDGRENPPPNGIKTSNQISGCPRHVKVRNLENGSSFLDTLHLTAKEVINCRTKACQG
ALMTPKGLVKGSRDGPVPPQELLPQAIDFVKQYYSSFKEPKIEEHLARLETVTKEIETTG
TYQLTKDELIFAAKQAWRNAPRCIGRIQWSNLQVFDARDCKTAKEMFEHLCRHIQYATNN
GNIRSAITVFPQRTDGKHDFRVWNSQLVRYAGYQMPDGSVVGDPASVEFTQLCIELGWKP
KYGRFDVVPLVLQANGQDPEIFEIPPEIVLEVPMEHPKYEWFKELDLKWYALPAVANMLL
EVGGLEFTACPFNGWYMGTEIGVRDFCDVQRYNILQEVGRRMGLETNKLSSLWKDRAVVE
INVAVLYSFQKQNVTIMDHHSAAESFMKYMQSEYRARGGCPADWVWIVPPMSGSITPVFH
QEMLNYVLTPFYYYQVDAWKTHIWHDETRRPKKKEVKFSILAKAVLFASSLMRRTMATRP
KATVLYATETGKSETLAHNLCSLFNRAFSTKILCMDEYNISDLEEETLLLVVTSTFGNGD
SPNNGKTLKNSLLNLKVLRKKIRYAVFGLGSSMYPEFCAFAHDIDQKLAELGAAQLTAIG
EGDELNGQEEAFRTWAVGAFKTACDVFNIRGRASIQLPELYTCAERWDPKSYRVVHDPQT
MDLTKALASIHAKDVIPMKLKFRRNLQSLKSSRVTILVKLSCEAGREVRYLPGEHIGIFP
GNQPQLVSGLIAHVKDAPPADQAVRLETCVAGGYWTSDRKIPACTLSEALTYLLDITTPP
SQQLLKNLSQLVTAEGDKQRLQVLCQSTEEYNKWKFHNSPNILEVLDAAPXPLLKPRYYS
VSSSCDMTPGEIHLTVAVVRYRTRDGQGPLHHGVCSTWLNTIALNDVVPCFIRSANEFQL
PEEPTKPCILIGPGTGIAPFRSFWLQRLCDMEKKGIKGGDMTLLFGCRQPDMDHIYKEET
EEMKRKGVLKDIYTAYSRQPGQAKVYVQDILQSKLETKVYNLVHKEEGHLYVCGDVRMAR
DVAQTLKGMFAKKLNLSEQQAEEYFFQLKSQKRYHEDIFGAVFPAEVKSGVRALQSAGPR
TNQPTF
NT seq 3441 nt   +upstreamnt  +downstreamnt
atgatgtgcccatggcagtttgtcttcaaacctcgtgctgctaagaaccggttctccgaa
gagcaggatatcaacaataacgtggagaaacactggacaatccatggcttagaaaatgat
gataccaaattgtgtgatgtggacaagaagcagacagagatgccgcccgcgcccagctca
gcgaaggccggtgatggcagagagaacccacccccaaatggtatcaaaacttcaaaccaa
atttcaggatgtccaagacatgtgaaagtaagaaacttggaaaatggatccagctttctc
gatacactacacctgacagcaaaggaggttatcaactgccggaccaaagcctgccaaggg
gcactcatgacccccaagggcctggtgaaaggttccagagatgggccggttccaccccaa
gagcttttgcctcaggcgatagactttgtcaagcagtactacagctcatttaaagagcca
aaaatagaagaacacctggcccgactggaaacagtgaccaaggagatcgaaacaacagga
acctaccagctgaccaaggatgagctgatcttcgctgccaagcaggcctggcggaacgcg
cccaggtgcattgggaggatccagtggtccaacctgcaggtatttgatgcacgtgattgt
aagacagcaaaggaaatgttcgagcatctctgtcgtcacattcagtatgccacaaacaat
ggaaacataaggtcagccatcactgtcttcccccagaggactgacgggaaacacgacttc
cgtgtttggaacagccagctggtccgatacgctgggtaccaaatgccagatgggtctgtt
gtgggagacccggccagcgtggagttcactcagttgtgcattgagcttgggtggaagccg
aagtacggccgctttgatgtagttccacttgttcttcaagcaaatggccaggacccagaa
atatttgaaatccctccagaaattgtccttgaagtgccaatggaacatccaaagtatgaa
tggtttaaggagctggatctgaagtggtacgcgctgccggctgttgccaacatgcttctt
gaggtgggaggcctggaattcacggcgtgtcccttcaacggctggtacatgggtacggag
ataggagtgcgagacttctgcgacgtgcagcggtacaacatcctgcaggaggtaggaaga
agaatgggtctggaaacaaacaaactttcatccttatggaaagaccgagctgttgtagag
ataaatgtggctgtgctttacagcttccaaaaacagaacgtgactatcatggatcaccac
tcggctgccgagtccttcatgaagtacatgcagagcgagtaccgagcgcggggaggctgc
ccggccgactgggtgtggatcgtgcctcccatgtcagggagcatcactcccgtgttccac
caggagatgctcaactatgtcctcactcccttctattactaccaggtggacgcatggaaa
acacatatctggcatgatgagacccggcggccaaagaaaaaggaagtaaagtttagcatc
ttggcaaaggccgtcctctttgcatcttcactcatgcgacgaacaatggcaaccaggccc
aaggcaactgtactctatgcaacagagaccgggaaatcagaaacactggcccacaacctg
tgtagcctgtttaaccgtgccttcagcaccaagattctgtgcatggatgagtacaacatc
agtgacctggaagaagaaacccttctcttagtggttacgagcacctttggaaatggagat
tctccaaataacggcaagaccttgaagaactccttgctcaatctgaaagtgctgaggaaa
aaaattagatatgctgtgtttggtttggggtccagcatgtacccggagttctgtgccttt
gctcatgacattgaccaaaaactggcggagctgggggctgctcagctcacggccataggg
gaaggagatgagctcaacgggcaagaagaggcctttcgcacatgggcagtcggtgccttc
aagactgcctgtgatgtttttaacatccgtgggagagccagtattcagctgcctgagctg
tacacctgtgctgagcgctgggaccccaagagctacagggtagtgcatgaccctcagacc
atggacttgactaaagcgcttgcaagcattcacgccaaggatgtaattcccatgaagctg
aaattcagacggaatcttcaaagtttaaaatccagtcgagtgaccattctagtgaagctt
tcctgcgaggccggtcgggaagtgcgctacctgcccggagaacatatcgggattttccca
ggcaaccagccacaattagtcagtggcctcattgcacatgtcaaggatgcccctccagct
gatcaggctgtcagactggaaacctgcgtggctggtggctactggacaagtgacaggaag
attccggcctgcacgctctctgaggctttgacatacttgctcgatatcaccactccaccc
tcccaacagctgctaaaaaacctctcccagctggtgacagcggaaggcgacaagcagaga
ctgcaagttttgtgtcagagcacggaagaatacaataagtggaagtttcacaacagcccg
aacatcctggaggtcctggatgccgcccctnngccgctcctgaagcccaggtactattcc
gtcagctcctcctgcgacatgacgcccggagagatccacctgaccgttgcggttgtacgc
tacaggacaagggatggacaagggcctttgcaccatggagtctgcagcacgtggctgaat
acaatagctctcaatgacgtagttccatgctttatacgcagtgctaatgaattccagctc
ccagaggagccaaccaagccgtgcattctgatcggcccaggaacaggaatcgctcccttc
aggagtttctggctgcagcgtctgtgtgacatggagaagaaagggatcaaaggtggtgac
atgacgttattgtttggctgccggcagccagacatggatcacatctacaaagaagaaacg
gaggaaatgaagaggaagggagtcctgaaagacatctacacagcttactccagacagcct
ggccaagctaaggtttatgtccaagatattcttcaaagcaagctggagaccaaagtgtac
aaccttgtgcataaggaggaagggcacctgtatgtctgcggagacgtgcgcatggccagg
gacgttgctcagactttgaaagggatgtttgcaaagaagctgaacctcagcgagcagcag
gcagaggagtatttcttccagctaaagagccagaagcgataccatgaagacatatttggg
gctgtattcccagctgaagtcaaaagtggtgtaagagctttgcaatccgccggtccaaga
acaaatcaacctacgttttag

DBGET integrated database retrieval system