KEGG   Columba livia (rock pigeon): 102092604
Entry
102092604         CDS       T02912                                 

Gene name
MDM4
Definition
(RefSeq) protein Mdm4
  KO
K10127  protein Mdm4
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102092604 (MDM4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:clv04121]
    102092604 (MDM4)
Ubiquitin system [BR:clv04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    102092604 (MDM4)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zinc_ribbon_15
Other DBs
NCBI-GeneID: 102092604
NCBI-ProteinID: XP_005510393
UniProt: A0A2I0LZV6
LinkDB
Position
Unknown
AA seq 474 aa
MTSSSSAQPPAAESACRLTLGQVNQVRPKLPLLKLLQAAGAQGETFTLKEVMHYLGQYIM
VKQLYDKNQQHMVYCGGDQLGELLGLESFSVKDPSPVYDMLKRNLTSAAMADAAQSLAKE
QSVDKPSQDQLKCSQREGSDTGVMEGESNSAALSTSEQPCAKHPDKDFIENLSKSKKPKL
DLVFEEWDVAGLPWWFLGNLRSNYKSRSNGSTDIQTNQDIDTAVVSDTTDDLWFLNECPS
DQSGATVKVEAVDCEEAKEGDKKVTEDTCLQDFEDSQRLSDDTDTEAASEGCWQCTKCRK
FNSPGKRYCYRCWALRKDWYSDCPRLAHSLSLSDIDAVQNKALDDGIDVPDCRRTVSAPI
GQPKDLYLVENKSRVDPGSSIESLDLARECESKKSLLHFAEHKKEEEIQSLESIKKLLSP
CFLCHHRPRDGNIVHGRTAHLVACFRCAKMLKKKRSPCPVCRKDIEMVIRIFMG
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgacatcttccagctctgcccagcctccagcagctgagagcgcctgccgcctcacactg
ggccaagttaaccaggtgcgacccaaactgccacttctgaagcttctgcaggctgcgggc
gcccagggtgaaaccttcacgctgaaggaggtgatgcattacctgggacagtatataatg
gtaaagcagctctatgacaaaaaccaacaacacatggtctattgcggaggagatcagctg
ggagaactgctggggctggagagcttctctgtgaaagacccaagcccagtgtatgacatg
ttgaaacggaacctgacttctgctgctatggcagatgccgcacagagtctcgcaaaggaa
cagagcgtcgataagccaagccaagaccagctgaagtgtagccagcgggaaggttctgac
actggcgtcatggagggcgagagcaattctgctgctttgtctacctcagagcaaccatgt
gcgaagcacccagacaaagacttcatagaaaacctctctaaaagcaagaagcctaaactg
gacctcgtgtttgaggaatgggatgtagctggtcttccgtggtggtttttaggcaacctc
agaagcaattacaagtccagaagtaatggatcaacagatattcagactaaccaggacatc
gacaccgccgttgtttccgatactactgatgacttgtggttcctcaacgagtgcccgtcg
gatcagagcggcgccacagtcaaggtggaagcggttgattgcgaggaagcaaaagaaggt
gacaaaaaggtgaccgaggacacatgtttgcaagactttgaggattctcaacgcttaagt
gatgacaccgacacagaagctgcttctgagggctgctggcaatgcaccaagtgcaggaag
ttcaactctccaggcaaacggtactgctaccgctgctgggccttgcgcaaggactggtac
tcggactgccccaggctggcgcactcgctgtctctgtcagacattgacgctgtgcagaac
aaagccctcgatgacggcatcgacgtccccgactgccgaaggaccgtttctgctcccatt
ggccaacccaaagacctgtacctggtagaaaacaaatcccgggtagatcccggcagctct
attgagtctttggatttggcacgagagtgtgaaagcaaaaagtctctcttgcattttgcc
gagcataaaaaggaggaagaaatacagtctttagagagtataaaaaaattactgagtccc
tgcttcttgtgccatcacagaccgcgggacgggaatatcgtccacgggaggactgctcac
cttgtggcctgtttcaggtgtgccaagatgctgaagaagaagcgatcgccgtgtccggtg
tgcaggaaggacatcgagatggtgatcaggatcttcatgggctag

DBGET integrated database retrieval system