KEGG   Columba livia (rock pigeon): 102092757
Entry
102092757         CDS       T02912                                 

Gene name
GTSE1
Definition
(RefSeq) G2 and S phase-expressed protein 1 isoform X1
  KO
K10129  G-2 and S-phase expressed protein 1
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102092757 (GTSE1)
SSDB
Motif
Pfam: GTSE1_N KI67R
Other DBs
NCBI-GeneID: 102092757
NCBI-ProteinID: XP_005498167
UniProt: A0A2I0MH60
LinkDB
Position
Unknown
AA seq 721 aa
MEEGKEISADCSSHVTEEKTSICMKNVSDIPLLIDEKFDFDLSLSPASGNEDEVFFGPLG
HKEKCIAVHIEAKKCAEKKRLPPDDKLMWSPLMGENFVEISKEAHSLALQIQTVSNNEQT
KISQSEEQENKIIEKFVEDPKSKLKILRNQNIERSPRAVKRETYCVQDSPACQLPRYFQK
ESDKLLSDDKTHALHTSPNRSPGKICVSPMKIASSPLTQEQKTKKINMKAPGKLPMAKPS
SALGKSYLFTTEKPGSGKHASISTQRDSNSMGSSEDPVSDKSSAASDVFESSFGSSSSVQ
DKKALPAPSKPGLKKITHLKLPGVASGLTRRTSSVSSMNSSLNSSLPISPIGKNGKSSVS
SKASVSGSRLSSSTNRLGLVRPTSVSSLQAANTEKFRKQARSSTPKTSSAVSLAKSSASV
IPSEAVSSGVQKLISVPGLQNLCQQTKDGSATRGSLCPKPRARLLSVPASLTKVPVKTGG
TPTSKLAPKATPSHGLAFCGTPGSAMAVSTPVTASGDGTFHNPCFPEMSVSMTPASLKHS
GLPTPVRRIPGFPAVTPKSAPRMALSPCAAPVCQSSSFSMKKILTAGSKQTKETKTQVSS
SEDDTSPPPVLPLALDFSPEKAAAEVAENKIREAEVQNQLAEEKQTEALLVDIGIDKSFP
HTLECESRPLIDLSNTPEVNKIIPLKPTFSGQVKLIDLSSPLITLSPDVNKENLDSPLLK
F
NT seq 2166 nt   +upstreamnt  +downstreamnt
atggaggaaggaaaagaaatatcagcagattgctcaagtcatgtgactgaagaaaaaaca
agtatctgtatgaagaatgtttcagacattcctcttctaattgatgaaaagtttgatttt
gacctttcactctctccagcaagtggaaatgaagatgaagtgttttttggacctctgggg
cacaaagaaaaatgtattgctgtccatattgaagcaaaaaaatgtgctgaaaaaaagaga
ctgcctcctgatgataaactgatgtggagcccacttatgggagagaactttgtggaaatt
agcaaagaagctcattcattagcactgcaaatacagactgtaagcaacaatgaacagact
aaaataagccaatcagaagaacaggaaaacaagattatcgaaaaatttgtggaggaccca
aagtcaaaactgaaaatattgagaaaccaaaatatagagagaagtcccagggctgttaaa
agggagacatactgtgtgcaggatagcccagcatgtcagctgccacgttattttcagaag
gaatcagataaacttttgtcagatgataaaacacatgctcttcatacttctccaaacaga
agccctggtaaaatttgtgtatctcctatgaaaattgccagttcacctctgacacaagaa
cagaaaactaagaaaataaatatgaaggcacctggcaaactcccaatggcaaaaccttca
tctgctcttggaaaaagctatttgtttactactgaaaagcctggatcaggaaaacatgct
agtatttctacacaaagagactcgaacagcatgggatcatctgaagatccagtttctgat
aaatctagtgctgcttcagatgtctttgagtcttcattcggtagcagttcctcagtgcaa
gataaaaaagctcttcctgcaccaagtaagcctggcttgaagaagataacacatctgaaa
cttcctggtgttgccagtggtctcacaagaaggacttcatcagtttccagcatgaactca
agtctgaattcaagtttacccatttctcccataggaaaaaatggaaagtcaagtgtgtct
tcaaaagccagtgtgagtggctctaggctttcttctagcacaaacaggctgggcttggtc
agacccaccagcgtatcatctctgcaggctgccaatactgagaaattcaggaagcaggcg
agatctagtactcccaaaacatccagtgctgtaagcttggctaaatcttcagcttctgtg
ataccatctgaggctgtaagcagtggagttcagaagctgatctctgttcctggtctacag
aacctatgtcagcagactaaagatggaagtgcaacaagaggaagcctgtgtccaaagccc
agggctcgacttttgtctgttcctgcaagtctgactaaggttccagtgaagactggaggt
acaccaacaagcaaactggcaccaaaagcaacaccatctcatggactagcattttgtggt
acacctggaagtgccatggcagtcagcactcctgtaacagcttcaggagatgggaccttt
cacaacccttgctttcctgagatgtctgtctccatgactcctgccagtctgaaacattct
ggcttacctacacctgttcgccgtatcccaggatttccagcagtgactcctaaaagtgca
ccaagaatggcgctttctccatgtgctgcacctgtttgtcaaagttccagcttttctatg
aaaaagattcttacagctggttctaaacagacaaaagagactaagacacaggtgtcttca
tcggaagatgatacatctcctccacctgtgctgcctcttgcacttgacttctcaccagaa
aaagctgctgcagaagtagcagaaaacaaaataagagaggctgaagtacaaaatcagctg
gctgaagagaaacaaactgaggccttgctggtagatattggaatagacaaatctttccca
cacactttggaatgtgaaagcagacctctgattgacctttccaatacccctgaagtgaat
aagattattcctctaaagcctacattctcagggcaggtaaagctaattgatttgagttca
cctcttatcactctgagtcccgatgtaaacaaagaaaatctggattcccctctgctcaag
ttctga

DBGET integrated database retrieval system