KEGG   Columba livia (rock pigeon): 102097231
Entry
102097231         CDS       T02912                                 

Gene name
PMAIP1
Definition
(RefSeq) phorbol-12-myristate-13-acetate-induced protein 1
  KO
K10131  phorbol-12-myristate-13-acetate-induced protein 1
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
clv04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102097231 (PMAIP1)
   04115 p53 signaling pathway
    102097231 (PMAIP1)
SSDB
Motif
Pfam: PMAIP1
Other DBs
NCBI-GeneID: 102097231
NCBI-ProteinID: XP_005508135
LinkDB
Position
Unknown
AA seq 54 aa
MMPGRNLRKSAPPAAPAEREVAVECALQLRRIGDKWDLRQRILNLLAKLFFPET
NT seq 165 nt   +upstreamnt  +downstreamnt
atgatgcccgggagaaacctgcgcaagtctgcgccgcccgccgctcccgcagagcgggag
gtggcggtggagtgtgccctgcagctccgcaggatcggcgacaagtgggacctgcggcag
aggatcctgaacctcctcgccaagctgttcttcccggaaacgtga

DBGET integrated database retrieval system