KEGG   Columba livia (rock pigeon): 102097507
Entry
102097507         CDS       T02912                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04010  MAPK signaling pathway
clv04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102097507 (CACNA1E)
   04020 Calcium signaling pathway
    102097507 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:clv04040]
    102097507 (CACNA1E)
Ion channels [BR:clv04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102097507 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 102097507
NCBI-ProteinID: XP_021141417
LinkDB
Position
Unknown
AA seq 2468 aa
MLGFGTCSVSVPAPGRGAELDPASPHYVLALPEEETWRKHRLGLMQTTQSCNLLEPESLA
EALVSRAASFDALYEPRSRDADTETGNTLDLGMGQYGPISPDVIKRRRGGLIEQRDIIKA
HEAHKMQSTPQARRKEWEMARFGEAVAGRLGSGDGGSDQNRSRQGPPAPAGGTPGPFKQT
KAQRARTMALYNPIPVRQNCFTVNRSLFLFAEENIVRKYAKKLIDWPPFEYMILATIIAN
CIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFVFHKGSYLRNGWNV
MDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLL
QIGLLLFFAILMFAIIGLEFYSGKLHRACYTNNSGELEELDPPHPCGVQGCPPGYECREW
IGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFV
LNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNS
GTSALEVLRRATIKRNRTDAMNRDSSDEHCVDIASVGERRLAQRRPLHPTLGNPMSHSGL
KGARVDGASYLRHKERLLRISVRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPAWLTHF
LYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDCGVTVGSIFEVVWAIFRPGTSFG
ISVLRALRLLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGG
RFNFIDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVRSGMWSSIYFIILT
LFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPAIE
RDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQEGINKDEPPLINP
HASIFRRKKPGDGVTLEKCAEEQGSKGEGPEQPAPGANPGSGEDRRSPSPRAKRDKELWQ
QKSCHGNCELGEQDGAGGGIEDRARMRQSQRRSRHRRARMEGKEPASALGSRSASQEMGL
EEASPTEGTQDGDLCGDTAAAEALIQGEPEASAEPSRTNGVPAGDAELVRTTKEGSTSQV
PPEPPRGKIGSLTEQDCGSLDTSEQALLETSRTISRSEPDLSSVTPNTEKATESTTIMID
VHDSAVVQISNKTDGEASPLKEAETKEDEEEVEKKKRKKEKSETGKAMVPHSSMFIFSTT
NPVRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSDRNKVLRYFDYVFTGVFTF
EMVIKMIDQGLILQDGSYFRDLWNILDFIVVVGALVAFALANALGTNKGRDIKTIKSLRV
LRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCT
DSSKDTEKDCIGNYVDHEKNKMEVKCREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQ
HSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSL
EKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKY
YSAPYTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEIIL
TDTKVKQRLGKVGCTTVRSGVYLGAGGGRGHPPTPDPLFIPSQLVNTSSFNMSFLKLFRA
ARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHI
NRHNNFRSFLGSLMLLFRSATGEAWQEIMLSCLEGKGCEPDTTATSGQNENERCGTDLAY
VYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRIWAEYDRAACGRIS
YKDMYKLVRVISPPLGLGENCPYRVACKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIK
IAKGGADWQQLDSELQKEILTIWPHLSQKMLDLLVPMPKTSDLTVGKIYAAMMIMDYYKQ
SKAKKQRQQLEEQKNAPMFQRMEPSSLPQEIISNAKALPYLQQDTLSGLSSRSGFHSLSP
LSPQEIFQLACMDPAHGQFQEHQSLEPEVREFQRVQPSNRGSYLPVDTQDHAVSGRASSM
PRLTVDPQVVTDTSSMRRSFSTIRDKRPNSSWLDEFSMERSSDNTYKSRRRSYHSSLQLS
ARRLNADSGHRSDGHRSGGRERGRSKERKHLLSPDISRCNSEERSPQAQDESPERRRESR
SPSEGRSQTPNRQGTGSLSESSIPSISDTSTPRRGRRVPPKPRPLLSYASMLRHTGDASP
PPEETEGGSPLLSSSLEPNTAGLTESSSSPAGKQSRQSTPHRYISEPYLALHDDSHTSDC
GEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRRGAGQGVMCGASIDVLS
DTEEDDKC
NT seq 7407 nt   +upstreamnt  +downstreamnt
atgctgggattcggcacatgctccgtcagtgtcccagcaccgggcaggggggctgagctg
gatcctgcctccccgcactacgtcctggccctgcccgaggaggagacatggcgcaaacac
aggcttggcttgatgcaaaccacccagtcctgcaacctgctggaacccgagagcctggct
gaagccctggtctcccgagccgccagcttcgatgccctctacgagccgcgctccagggac
gctgatacggaaacaggcaacaccttggacctggggatgggccagtacggccccataagc
cctgatgtgatcaagcgccggcggggagggctgatcgagcagagggacatcatcaaagcg
cacgaggcgcataagatgcagagcacaccgcaggcacggaggaaggagtgggagatggct
cgctttggggaggcagtggctggcaggctgggctccggagatgggggctctgaccagaac
cggagccggcaaggacctcctgctcctgcgggagggaccccaggacccttcaagcaaacc
aaagcacagagagctcggactatggctctgtacaaccccatccctgtccggcagaactgc
ttcactgtcaacagatcgctctttctctttgcggaagagaacatagtcaggaaatacgct
aagaagctcatcgactggcctcccttcgaatacatgatcctggcaaccatcattgccaac
tgcatcgtgctggccctcgagcaacacctccccgaggatgacaagacgcccatgtcacgg
agattagagaagacagagccctacttcatcgggattttctgcttcgaggctgggattaag
attgtggctctggggtttgttttccacaagggctcatacctgcgcaatggctggaacgtc
atggacttcatcgtggtcctcagcggcatccttgccaccgctgggacacacttcaacacc
cacgtggacctgcggacgctgcgggccgtgcgtgtgctcagacctctgaagctcgtctca
ggcattcccagcctgcagattgtgctcaaatccatcatgaaggccatggtgcctctcctc
cagattggcttgctactcttttttgctatcctcatgtttgccatcatcggcctggagttt
tacagcgggaaactgcatcgagcctgctacacaaacaattcaggtgaactggaggagctg
gaccctccccatccatgcggggtgcagggttgtcccccaggctatgagtgccgggagtgg
attggtcccaacgacgggatcacgcagttcgacaacatcctctttgctgtgctgaccgtc
ttccagtgcatcaccatggaagggtggaccacagtcctgtacaataccaatgatgcctta
ggagccacctggaactggctgtacttcatccccctcatcatcattggatccttctttgtc
ctcaaccttgtcctgggagtgctgtcgggggagtttgccaaagagagggagcgagtggag
aaccgccgagctttcatgaagctgcggcgccaacagcagattgagcgggagctcaatggc
taccgggcctggatagacaaagcagaggaagtcatgctggctgaagagaacaaaaattct
gggacctcagccttagaagtgctcaggcgagccaccatcaaaaggaaccggacagatgcc
atgaaccgcgactcaagtgatgagcactgcgttgatatcgcctccgtgggtgagcggagg
ctggcacagagaagaccccttcatccaaccttaggtaatcccatgagtcactctggcctc
aaaggtgccagagtggacggtgcctcctacttacggcacaaggagcgactcctgcgcatc
tctgtccgccacatggtgaaatcacaggtcttctactggattgtcttgagcttggtggct
ctcaacactgcctgtgtggccatcgtccatcacaaccagccagcctggctcacacatttc
ctctactatgcagagtttctgtttcttgggctcttcctcctggagatgtccttaaagatg
tacggaatggggccacgcctttacttccattcttccttcaactgctttgactgtggggtc
acagtgggaagcatcttcgaagtggtttgggctatcttcaggccaggaacctcttttggg
atcagtgtcctacgagcccttcgtctactacgaatatttaaaataaccaagtactgggca
tccctgaggaatttggtggtctcactgatgagctccatgaagtctattatcagcctgctc
ttcctcctcttcctattcattgtagtctttgccttgctgggaatgcagctgtttggaggc
aggtttaacttcatcgatgggacaccatcggccaacttcgacactttccctgcagccatc
atgacagtgtttcagatcctgacaggtgaggactggaacgaggtgatgtacaatggcatc
cgctcccagggaggtgttcgctcgggcatgtggtcctccatctatttcatcatcctcacc
ttgtttgggaactatactctgctgaatgtgttcttggccattgcggtggacaacctggcc
aacgctcaggagctcaccaaggatgagcaggaggaagaggaggcctttaaccagaagcat
gcccttcagaaagccaaagaagtcagccctatgtctgcgccaaacatgcctgctatcgaa
agagacaggcggaggagacaccacatgtcgatgtgggagccacgcagcagccacctgcgg
gagcgtcgccggcggcaccacatgtcggtgtgggagcagcgcaccagccaactgcgccgg
cacatgcagatgtccagccaggagggcatcaacaaggacgagccgcccctcatcaacccc
cacgccagcatcttccgcaggaagaaaccgggggacggtgtcaccctggagaaatgcgct
gaggagcagggcagcaagggcgagggacccgagcagccggccccaggtgccaaccccggc
agtggggaggacaggaggagcccatcaccccgtgccaagcgagacaaggagctgtggcag
cagaaatcctgccatgggaactgcgagctgggtgagcaggatggggcaggaggtggcatt
gaggacagggcgcggatgaggcagagccagcggcgcagccggcaccgcagagcccggatg
gaggggaaggagccagccagtgcactggggagccgctcggccagccaggagatgggtctg
gaggaggccagccccacagaggggacacaggatggggacctgtgtggggacacggctgca
gcagaagcactgattcagggggagccagaggcaagcgcggagcccagcaggacaaatggg
gtccctgctggcgatgccgagctggtcaggaccaccaaggaggggagcacctcacaagtc
ccacccgagcccccccgggggaagataggcagcctgacggagcaggactgcggcagcctg
gacaccagcgagcaagcattgcttgaaacttcccgcaccatcagccggagcgagcccgac
ctctcctccgtcacccccaacaccgagaaggctacggagagcaccaccatcatgattgat
gtccacgactccgctgtggtacagattagcaacaagacagatggtgaagccagcccctta
aaggaggctgagaccaaagaggatgaggaggaggtggagaagaagaaacggaagaaggag
aaaagtgagacgggcaaagcgatggtaccacatagctccatgttcatcttcagcaccacc
aacccggtgcggagggcttgccactacatcgtcaacctgcgctactttgagatgtgcatc
ctcctggtgattgccgccagcagcatcgccctcgcagcagaggatcctgtcctcaccaac
tctgaccgcaacaaggtcctgaggtactttgactatgtcttcactggcgtcttcaccttt
gagatggttatcaagatgatcgatcagggcttgatcctgcaggacggctcctacttccga
gacctctggaacatcctggatttcatcgtggtggtgggagcgctggtggcttttgctttg
gcgaatgctttggggaccaacaagggccgggatatcaagaccatcaagtctctccgtgtg
ctacgggtcttgaggcccctgaagaccatcaagcgactgcccaagctgaaggccgtcttc
gactgtgttgtgacctccctcaagaacgtcttcaacatcctcatcgtctacaagctcttc
atgttcatctttgctgtcattgctgtccagctattcaaggggaagtttttctattgtact
gacagctctaaggacacggaaaaggactgcatagggaactatgtggaccacgagaagaac
aagatggaggtgaagtgccgggagtggaaacgccatgagtttcactacgacaacatcatc
tgggctttgctcaccctgttcacagtctccactggcgagggttggccccaggtgctgcag
cattcggtggacgtgacggaggaggaccgtgggcccagccgcagcaaccgcatggagatg
tccattttttatgttgtatattttgtggtcttccctttcttcttcgtcaacattttcgtg
gctctcatcatcattacgttccaagaacaaggagacaaaatgatggaggagtgcagtctg
gagaagaacgagagggcctgcatcgactttgccatcagtgccaagcccctcacacggtac
atgcctcagaaccgacacaccttccagtaccgtgtctggcactttgtagtctccccatcc
ttcgagtacaccatcatggccatgatagcgttgaacaccgtggtgctgatgatgaagtac
tactctgctccgtacacctatgagctggccctgaagtacctgaacatcgccttcaccatg
gtcttctccttggagtgtgtcctcaagatcatcgcttttggctttctgaattatttccgg
gacacctggaacatctttgacttcatcactgtcattggcagcattacggagatcatcctg
acggacaccaaggtgaagcagagactgggaaaagtggggtgtactactgtgagaagcggg
gtgtacctcggggcggggggggggagagggcatccacctacccctgaccctcttttcatc
ccctcccagctggtgaacaccagcagcttcaacatgagcttcctgaagctctttcgggcc
gctcggctcatcaagttgctgcgccagggttacaccatccgcatcctgctctggaccttc
gtgcagtccttcaaggccctcccctatgtctgcctcttgatcgccatgcttttcttcatc
tatgccatcattgggatgcaggtttttggcaatatcaaactagatgaggaaagccacatt
aaccggcacaacaacttccgcagcttcctgggctctctcatgctcctcttcaggagtgcc
acgggagaggcatggcaggagattatgctgtcctgcctggagggcaaaggctgtgagcca
gacacaacagcaacatccgggcagaatgagaacgaacgatgtggcactgacctggcttac
gtttacttcgtctccttcatcttcttctgctcattcctgatgctcaacctgtttgtggct
gtcatcatggacaattttgaatacctgactcgggattcctccatcctgggacctcaccat
ctagatgagtttgtccggatttgggcagagtatgacagagcagcgtgcggcaggatctcg
tataaggatatgtacaaattagtacgggtgatctcgcctcctctgggcctaggagagaac
tgcccctacagggtggcgtgcaagagactggtgctgatgaacatgcccgtggccgaggac
atgacggtccattttacctccaccttgatggcgctgatacgcacggccttggacatcaaa
attgccaaaggtggtgcagattggcagcagttagactccgagcttcaaaaggagatcctg
accatttggcctcacctgtcccagaagatgctggacctgttggtacccatgccaaaaacc
tctgacctgactgttggcaaaatatatgcagccatgatgatcatggattactacaagcag
agcaaagccaagaagcagcggcagcagctggaggagcagaaaaacgctcccatgttccag
cgcatggagccgtcctccttgccgcaggaaatcatctcgaatgccaaggctctgccttac
ctccagcaggacaccctctcgggcctgagcagccggagtgggttccactcactgagccca
ctctcgccgcaggaaatcttccagctggcgtgtatggatccagcccacgggcagttccag
gagcaccagtctctggagccagaggttagggagtttcaaagagtgcagccctctaaccgt
ggcagctaccttcctgtggacactcaggaccacgctgtctctgggagggcctcctccatg
cctcgtctcactgtggatccccaggtggtgacggacacgagctcaatgcggcgctcattt
tccaccattcgggacaagcgccccaacagctcctggctggacgaattctccatggaacgc
agcagcgacaacacctacaagtcccgccggcgcagctaccactcctcactccagctctcc
gcccggcgcctcaatgccgactcgggtcaccggtctgatgggcatcgctcgggtggcaga
gagaggggtcgatccaaagagcgcaagcacttgctgtcccctgacatctcccgctgcaac
tcagaggagaggagtccccaggcgcaggacgagtcgccggagcggcggcgtgagtcccgg
tcacccagcgagggcaggtcacagacacccaacaggcagggaacgggctccctgagtgaa
agctccatcccctccatctcggacaccagcaccccccggcgaggccgtcgcgtgcccccc
aaaccacgtcccctcctctcctacgcctccatgctgcggcacaccggagacgcctcgccg
ccccctgaggagaccgagggggggtccccgctcctctcctccagcttggagcccaacacc
gccggcttgaccgagtcttccagctccccagcagggaagcagagccgccagtccacccct
catcgttacatctcggagccctacctggccctgcacgacgactcgcacacctcagactgc
ggggaggaggagaccctcaccttcgaggcggccgttgccaccagcctcggccgttccaac
accatcggctcagctccaccgctgcggcacagctggcagatgcccaatgggcattatcgg
cggcggaggcgaggggcagggcaaggggtgatgtgcggggccagcattgacgtgctcagc
gacaccgaggaagatgacaagtgctag

DBGET integrated database retrieval system