KEGG   Columba livia (rock pigeon): 102097802
Entry
102097802         CDS       T02912                                 

Gene name
BCL2L1
Definition
(RefSeq) bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
clv04137  Mitophagy - animal
clv04140  Autophagy - animal
clv04210  Apoptosis
clv04621  NOD-like receptor signaling pathway
clv05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102097802 (BCL2L1)
   04137 Mitophagy - animal
    102097802 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    102097802 (BCL2L1)
   04115 p53 signaling pathway
    102097802 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102097802 (BCL2L1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102097802 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:clv01009]
    102097802 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:clv03036]
    102097802 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:clv02000]
    102097802 (BCL2L1)
Protein phosphatases and associated proteins [BR:clv01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102097802 (BCL2L1)
Chromosome and associated proteins [BR:clv03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102097802 (BCL2L1)
Transporters [BR:clv02000]
 Other transporters
  Pores ion channels [TC:1]
   102097802 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 102097802
NCBI-ProteinID: XP_005499593
UniProt: A0A2I0LMZ0
LinkDB
Position
Unknown
AA seq 230 aa
MSSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAAEEVEMDGVLNGSPSWHPPPSH
VVNGAAVHRSGLEVHEIIQTADVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSF
EQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMRVLVGRIVSWMTTYLTDHLDPWIQ
ENGGWERFVDLYGNNAAAEVRKGQETFNKWLLTGATVAGVLLLGSLLSRK
NT seq 693 nt   +upstreamnt  +downstreamnt
atgtccagcagtaaccgggagttagtgattgactttgtttcctacaagctctcacagaag
ggatacagctggagtcagctggaagaggaggatgagaacaggactgactttgccgcggag
gaggtcgagatggacggcgtcctcaacgggagcccctcctggcacccgccccccagccac
gtagtgaacggagctgccgtgcaccggagcggcctcgaagtccatgaaatcattcaaaca
gccgacgtgaggcaggcgctgagggaggcgggggatgagtttgagctgaggtaccggcgg
gcgttcagcgacctcacttcccagctccatatcacccctggcacagcgtatcagagcttt
gagcaggtagtgaatgaactcttccgtgatggagtgaactggggccgcatcgtggctttc
ttctccttcggaggagcgttgtgcgtggagagcgttgacaaggagatgcgggtattggtg
ggacgcattgtgtcttggatgaccacgtacttgaccgaccacctagacccctggatccag
gagaatggcggatgggagcggtttgtggacctctacgggaacaacgctgctgccgaggtg
aggaagggacaggagaccttcaacaagtggctcctgactggggcaacggtggcaggcgtg
cttctgctgggatccctgctgagccgcaagtga

DBGET integrated database retrieval system