KEGG   Celeribacter manganoxidans: CBW24_07195Help
Entry
CBW24_07195       CDS       T05128                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
cmag  Celeribacter manganoxidans
Pathway
cmag03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cmag00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CBW24_07195
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cmag03400]
    CBW24_07195
Enzymes [BR:cmag01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CBW24_07195
DNA repair and recombination proteins [BR:cmag03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CBW24_07195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: ATI41803
UniProt: A0A291LYI5
LinkDB All DBs
Position
1593232..1595688
Genome map
AA seq 818 aa AA seqDB search
MGRLDRYLERRDFSATPEPSDAGAAPALALRYSIQKHAATRTHFDLRLEWDGALLSWAVT
RGPSFHLGEKRLAVRTEDHPISYLEFEGNIPARHYGAGAVMLWDLGHWEPLTPVDKGLRK
GHLEFRLHGVRLSGAWHLIRMNTKEKRENWLLTKQEDEVAGRRDPVTQYRRGVTSRRSLA
EIRKDAPPVDLREGKRPRFAKPQLATLSDTLPEGDAWWHELKFDGYRGMVALGQGGPKAY
TRNGKDWSDRFASLLPAFDDLPCDSALIDGEIVAGAGIQGFSALQDALKTGGPFRFYAFD
LLERDGKDLTGAPLTDRRAELEDLWRGMSPLGRVQLSPIIERRPEQVFGDICSAGGEGLI
SKRIDAPYRHSRTKDWLKVKCELRDEFVILGWQPSDKRGRPFASLLLGANAGGEMRYVGK
VGTGFSEDDMDRLIRAMRPLSRKTPPAEADPADTRDAQWITPRLVAEVQYAERTANGLLR
HARYLGLREDKPAKDVEIDNDRSTEAVMDTDAGQSADKLTVAGLRISSGDRVVYPDAGIT
KAQVAEYYAALADRILPFAADRPLSLLRLPEGLKGETFFQKHAGKGFPDALREMALEESD
GGTASYMYVTDAAGLVGAAQMGALELHIWGSRRDRLDRPDRMVFDLDPDPGLGFADVTAA
ASDLRDRLEALGLPSWPLLSGGKGVHVVVPLRRVAGWDTVKLYARIFATLLASEEPDRFV
ATMSKAKRKGRIFIDWLRNERGATAIAPYSLRARAGAPVAVPVRWDDLRGYDSAQVFDLP
RVQAGDIPDPELPDPGSLTEPRISALEAALATAQEADD
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atggggcggctcgaccgatatctggagcggcgcgatttcagcgcgacgccggagccatcg
gatgcgggggccgcgcctgcgcttgccctgcgctacagtatacaaaaacacgccgcgacc
cgcacgcatttcgacctgcgtctggaatgggacggggcactgctaagctgggcggtcacc
cgtggtccctcgtttcatctgggggagaagcgactggccgtgcggaccgaagatcacccg
atctcctatcttgaattcgaaggcaatattcccgcgcgccattatggggcgggtgcggtg
atgttgtgggatctgggccattgggagccgctgaccccggtggataaggggctgcgcaag
ggccatttggagtttcgtctccacggtgtgcgtctgtcgggtgcgtggcatttgatccgt
atgaacacgaaggagaaacgcgaaaactggctgctgacgaagcaggaggatgaggtcgca
ggccgccgcgatccggtgacccagtatcggcggggcgtcaccagccgccgcagtctggcg
gagatacgcaaggacgcgccgcccgttgatctgcgcgagggcaagcgcccgcgctttgcc
aagccgcaattggcgaccctgagcgatacgctgcccgagggggatgcgtggtggcatgaa
ctgaaattcgacggctatcgcggcatggtggccttggggcagggcggtccaaaggcgtat
acccgcaatggcaaggattggtcggaccgtttcgccagcctgctgcccgcctttgacgat
ctgccatgtgacagtgcgttgatcgacggggaaatcgtggcgggcgctgggattcagggg
ttttccgccttgcaggatgcgctgaagacaggcggtccgttccggttctatgccttcgat
ctgctggagcgtgacggcaaggatctgaccggcgcacctttgacagaccgccgtgccgaa
ttggaggatctgtggcgcggcatgtctccactgggccgcgtgcagctatcccccatcatc
gaacgccgccccgaacaggtcttcggcgatatttgctcggccgggggggaggggctgatc
tccaaacggatcgacgcgccctatcgccatagccgcaccaaggactggctgaaggtgaaa
tgcgagttgcgggacgagttcgtcattctgggctggcaacccagcgacaaacgcgggcgt
ccgtttgcctcgctgctgttgggggccaatgccgggggggaaatgcgctatgtcggtaag
gtcggcacaggcttctccgaggatgacatggacaggctgatccgcgccatgcggcccctc
agccgaaaaaccccaccggcggaggccgacccggccgatacccgcgatgcgcaatggatc
acgccacggctggtggcggaggtgcaatatgccgagcgcacggccaacgggctgttgcgg
cacgcccgctatctgggcctgcgcgaagacaaacccgccaaggatgtggagatcgacaat
gaccgcagcacggaggccgtaatggatacggatgcagggcaatccgcagacaagctgacc
gtcgctggcctgcgtatcagcagcggcgaccgtgtggtctacccggatgccggcatcacc
aaggcgcaggtcgcggaatattacgcggctttggcggaccgcatcctgccctttgccgcc
gatcgcccgctatccctgctgcgtctgcccgaagggctaaagggagagacgttttttcaa
aagcacgcgggcaagggcttccctgacgcgttgcgcgaaatggcgttggaggaatccgat
ggggggaccgccagttacatgtatgtcaccgatgctgcggggttggtgggcgctgcgcaa
atgggggcgctggaattgcacatatggggcagtcgccgcgacaggctcgaccgaccggat
cgcatggtgttcgacctcgaccccgatccggggcttggctttgccgatgtgaccgcggcg
gcctccgatctgcgcgaccggttggaggcgctgggcctgccaagctggcctttgctgtcg
ggcggcaagggggtgcatgtggtcgtgccgctgcgccgtgtcgcgggctgggacacggtc
aagctatacgcgcgcatattcgccacgctgctggcctccgaagagcccgaccgtttcgtc
gccaccatgtcaaaggccaagcgcaagggccgcatctttatcgactggctgcgcaatgaa
cgcggcgccacggcgattgcgccgtattccttgcgcgcgcgggctggagcgcccgttgcg
gtgccggtccgctgggacgacttgcgtggctatgacagcgcacaggtgttcgacctgccc
cgcgtgcaggcaggcgacatccccgatccggaattgcccgatccggggagcctgaccgag
ccgcgcatctccgcgctcgaagcggcgcttgccaccgcgcaggaggcggacgactaa

DBGET integrated database retrieval system