KEGG   Croceicoccus marinus: A9D14_15040Help
Entry
A9D14_15040       CDS       T04890                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
cman  Croceicoccus marinus
Pathway
cman00071  Fatty acid degradation
cman00280  Valine, leucine and isoleucine degradation
cman00281  Geraniol degradation
cman00310  Lysine degradation
cman00362  Benzoate degradation
cman00380  Tryptophan metabolism
cman00410  beta-Alanine metabolism
cman00640  Propanoate metabolism
cman00650  Butanoate metabolism
cman00903  Limonene and pinene degradation
cman00930  Caprolactam degradation
cman01100  Metabolic pathways
cman01110  Biosynthesis of secondary metabolites
cman01120  Microbial metabolism in diverse environments
cman01130  Biosynthesis of antibiotics
cman01200  Carbon metabolism
cman01212  Fatty acid metabolism
Module
cman_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cman00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A9D14_15040
   00650 Butanoate metabolism
    A9D14_15040
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A9D14_15040
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A9D14_15040
   00310 Lysine degradation
    A9D14_15040
   00380 Tryptophan metabolism
    A9D14_15040
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A9D14_15040
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A9D14_15040
   00281 Geraniol degradation
    A9D14_15040
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A9D14_15040
   00930 Caprolactam degradation
    A9D14_15040
Enzymes [BR:cman01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     A9D14_15040
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     A9D14_15040
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     A9D14_15040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2 NAD_binding_8 DAO F420_oxidored 2-Hacid_dh_C UDPG_MGDP_dh_N Pyr_redox_2 FAD_binding_3 ApbA XdhC_C NAD_Gly3P_dh_N GIDA DFP
Motif
Other DBs
NCBI-ProteinID: ARU18129
UniProt: A0A1Z1FH53
LinkDB All DBs
Position
pCME4A9I:150966..153107
Genome map
AA seq 713 aa AA seqDB search
MKLDKGADGVAVLTLDNADESMNVVSAEWLEDMNAAIAELRDDESVTGVIIASGKKAFMA
GADLKLMVAGYETMTPKDAFAFSQKATAMHRALETMGKPVACAMNGLALGGGFELALACH
HRVLSDDPRAVVGLPEVNLGLLPGSGGTQRLPRLIGRKKGLDLLLSGRSVAPKEALELGL
VDEIAPIDQLVDKARQWLATNPPAERIWDVKGYAIPEMRGMIVPEVAMDYSIGVAQVAGK
HGYNYPAPAAILSCVFEGLQLPMDKALSVEGKYFAKLLTDPVARNIIRTTFISKQAAEKG
ARRPEGVPKSEVKKLGVLGAGMMGAGIALVAAKAGIDVVLIDRDTATAAKGKGYSEKVFG
KAVERGKMPQDKADSALAHITPTDDFALLDGCDLVVEAVFEDMGIKAETTQKAEAVLPES
AVFATNTSTLPISELAKASKRPDQYIGLHFFSPVDRMGLVEVIMGEQTSDETLAKSLDFI
AQIRKTPIVVNDAQGFYTSRVFRMFIFEGAAMLEDGVEPARIENAAKAAGFPIGPLALLD
EVTIDLPVKILKDAEGKDGNLYTIERGGKVLDRMLELGRGSRKAGAGFYEYAEDGSKHLW
EGLGTEFPVSDDQPDQEELKKRFLYSQANETAQCLEEGVLETAQDADLGAILGWGFPLWT
GGTLSYIDTIGIAEFAKEASKLAGNYGARFAPSKWLQDRAAAGTPFYPPIKAG
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atcaagctggacaagggcgccgacggcgtcgccgttctcacactcgacaatgccgatgag
agcatgaacgtcgtttcggccgaatggctcgaagacatgaatgccgcaattgcagagctg
cgcgacgacgagagtgttaccggcgtcatcatcgcatcgggcaagaaggccttcatggcg
ggcgccgacctaaagctgatggtcgcgggttatgaaaccatgacgcccaaggatgcattt
gcgttcagccagaaggcaacggcaatgcaccgcgcgctggaaacgatgggcaagccggtc
gcctgtgccatgaacggccttgcgcttggcggagggttcgaactggcactggcatgccac
caccgtgtgctgtcggacgatccgcgtgccgtcgtggggctgccagaagtcaatctgggt
cttttgccgggatcgggcggcacgcagcgcctgccgcgcctgattggtcgcaagaagggg
ctcgacctgcttctttccggccgttcggtcgcgccgaaggaagcgctggaactgggcctc
gtcgacgaaatcgcacctatcgaccagctggtcgacaaggcgcgtcagtggctggccacc
aatccgcccgcagagcggatatgggacgtcaagggttacgccattcccgaaatgcgcggc
atgatcgtgcccgaagtcgcgatggattattcgatcggcgtcgcacaggtcgcaggcaag
catggctataattacccggcgcccgccgcgatcctgtcatgcgtgttcgaaggcttgcaa
ttgccgatggacaaggcgctttcggtggaaggcaaatatttcgccaagctgctgaccgat
ccggtcgcgcgcaacatcatccgcacgaccttcatttccaagcaggctgccgaaaagggc
gcgcgccgccccgaaggcgtgccgaagtcggaagtgaagaaactgggcgtactgggcgcg
ggcatgatgggcgcaggcatcgcgcttgtcgcagcaaaggcggggatcgacgtggtgttg
atcgaccgtgatacggccaccgccgcaaaaggcaaaggctatagcgagaaagtcttcggc
aaggctgtcgagcgcggcaagatgccgcaggacaaggccgattccgcacttgcgcatatc
accccgaccgacgatttcgcgctgctcgacggatgcgatcttgtggtcgaggcggtgttc
gaggatatgggcatcaaggccgaaaccacgcaaaaggccgaagccgtcctgcccgagagc
gcggtctttgcgaccaatacctccaccctgccgatttcggagcttgccaaggcttccaag
cggccggaccaatatatcggcctgcatttcttttcgcctgtcgatcgcatgggactggtc
gaagtcatcatgggcgagcagacgtcggacgagacgctggccaagtcgctggatttcatc
gcccagatccgcaagaccccgatcgtcgtcaatgacgcgcagggtttctacaccagtcgt
gtctttcgcatgttcatcttcgaaggcgctgcgatgctggaagacggcgtggagcccgca
aggatcgagaatgccgcgaaggctgccggtttcccgatcggcccgctcgccctgctggac
gaggtgacgatcgacctgccggtcaagatcctcaaggatgcggaaggcaaggacgggaac
ctctatacgatcgagcgtggcggcaaggtgctcgaccggatgctcgaactcggtcgcggc
agccgcaaggccggtgccggcttctacgaatatgccgaggatggcagcaaacatctgtgg
gaaggtctgggcacggaattcccggtgtccgacgatcagcctgatcaggaggaactgaag
aagcgcttcctctactcgcaggccaatgaaaccgcgcaatgccttgaggaaggcgtgctc
gaaaccgcgcaggatgcggatctgggtgcgatattgggctggggcttcccgctttggacc
ggcggcacgctcagctatatcgacaccatcgggatcgcagaattcgcaaaggaagccagc
aagctggcgggcaattacggcgcccgattcgcgccatcgaaatggttgcaggaccgggcg
gctgcaggcacccccttctacccaccgatcaaggcaggttga

DBGET integrated database retrieval system