KEGG   Celeribacter marinus: IMCC12053_1785Help
Entry
IMCC12053_1785    CDS       T04098                                 

Definition
(GenBank) NADP-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
cmar  Celeribacter marinus
Pathway
cmar00620  Pyruvate metabolism
cmar01100  Metabolic pathways
cmar01120  Microbial metabolism in diverse environments
cmar01200  Carbon metabolism
Module
cmar_M00169  CAM (Crassulacean acid metabolism), light
Brite
KEGG Orthology (KO) [BR:cmar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    IMCC12053_1785
Enzymes [BR:cmar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     IMCC12053_1785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ALI55732
UniProt: A0A0P0AAE3
LinkDB All DBs
Position
1750218..1752479
Genome map
AA seq 753 aa AA seqDB search
MSKIKQTREEALAFHMDPRPGKFDIAPSVPMSTQRDLSLAYSPGVAVPCEAIAANPETAY
DYTNKGNLVAVISNGTAVLGLGNLGALASKPVMEGKAVLFKRFADVNSIDIELDTEDPDQ
IIQAVKLMGPTFGGINLEDIKAPECFIIEQKLKEEMDIPVFHDDQHGTAVICAAGLINAL
HISGKCIEDCKIVLNGAGAAGIACLELIKSMGAKHDNCIMCDTKGVIYQGRTEGMNQWKS
AHAAKTDARTLGEAMVGADVFLGVSAKGAVTSDMVAAMAPNAVIFAMANPDPEITPEDAH
AVREDVIVATGRSDYPNQVNNVLGFPYLFRGALDIHARAINDEMKIACAEALAALAREDV
PDEVALAYGRSLTFGRDYIIPTPFDPRLIYTIPPAVAKAGMDTGVARRPIVDMDGYAHGL
KARMDPTAQILQGLYARARQAQATMLFAEGDDLRVLRAAVAYQRGGYGKALIVGRDEDVN
AKLNEAGLSDAAGELEIVNAANTPHLDSYKAFLYDRLQRSGHDQKDIHRLAARDRHAFSA
LMLAHGHADGLVTGATRKSAHVLDRINSVFDATAEDGAIGVSALIHNGRIVFIADTLVHE
WPDEHDLADIAEAAAKVARSMGIEPRVAFASFSTFGYPVSERASKMHLAPKVLDSRKVDF
EYDGEMTVEVALNTDAMAAYPFCRLTGPANILVVPARHSASISVKLMQEMAGATVIGPIL
TGVDKPIQVCSTVSTVNDILNMAILAACKVGQS
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaataaaacaaacccgcgaagaagcactcgcttttcacatggatccccgcccg
gggaagtttgacattgcgccaagtgtgccgatgtcaacgcagcgcgatctgtcattggca
tattcgccaggggttgccgttccgtgcgaggcgatagccgcaaatcctgaaacagcatac
gactacactaacaaaggtaatctggttgctgtgatttccaacggcaccgctgttctaggt
ttgggtaatcttggcgctctggcatctaagccggtgatggaaggtaaggcggttctgttc
aaacggtttgctgatgtaaactcgatcgatatcgagttggacactgaagatcctgatcag
atcattcaggcagtaaagctgatgggtccgacatttggtggcataaaccttgaagatatc
aaagcaccagagtgctttatcattgagcaaaaactcaaagaagaaatggacatccccgtt
tttcacgatgaccaacacgggaccgcggtgatttgtgcggcgggtctgatcaatgcgctg
catatttctggtaagtgcattgaggattgtaaaatcgttctcaatggcgcgggtgcggcg
ggtattgcttgtcttgaactcattaaatcaatgggcgccaagcacgacaactgcattatg
tgtgacaccaaaggtgtgatctatcagggacgcaccgaaggtatgaaccagtggaagtct
gcccatgctgcaaagactgatgcgcgcacattgggcgaggctatggtgggcgctgatgta
ttccttggcgtttccgcaaagggtgcggtgacctctgacatggttgccgctatggcgcca
aatgcagttatttttgcgatggccaaccctgatcccgaaattactcccgaggatgcccat
gcggttcgcgaagatgtgattgttgccacggggcgttcggactaccccaatcaggtcaac
aacgttctcgggtttccatacttgttccgcggggcgctagatatccatgcgcgggctatt
aatgatgaaatgaaaattgcatgtgctgaggcattggcggctcttgcgcgcgaagatgtg
ccggatgaagttgcattggcatatgggcgctctctcacgttcgggcgcgactacattatt
ccaacgccgttcgatccgcgtcttatttacacgatcccccctgcagttgcgaaggcgggc
atggatacaggcgttgcgcgccgtccaatcgttgatatggatggatatgcgcatgggctg
aaggcgcgtatggatcctacggctcaaatccttcaggggctttacgcacgcgcgcgtcag
gcgcaggcaacgatgctttttgccgaaggtgacgatttacgggtgttgcgcgccgcggtt
gcctatcaacgtggaggctacggcaaggcgctcattgttgggcgagatgaggacgttaat
gccaagctaaacgaggctgggttgtcggatgcggcgggagagttagagattgtgaatgct
gcgaacacgccacatctcgatagctacaaagcatttttgtatgatcggttacaaagatcc
ggccatgaccaaaaggacattcatcgcctcgccgctcgcgatcggcatgcgttctctgcg
ttgatgctcgcacatggccacgctgacggacttgttacaggagcaacgcgcaagtcggca
catgttttggaccgtatcaattcggttttcgatgcaacggctgaggatggcgcaatcggt
gtgagtgcgctgattcacaacggtcgcatcgtcttcattgccgatacgttggtgcacgag
tggccggatgagcatgaccttgccgatattgctgaggccgccgctaaagtggcacgatca
atgggaatcgagcctcgtgtcgcatttgcgtcattttcgacgtttggctatccagtatca
gagcgcgcaagtaaaatgcacctcgcgccaaaggtcctggattcacgcaaggtcgacttt
gaatacgacggcgaaatgaccgttgaagttgcgcttaatactgacgcaatggccgcctat
ccattctgtcgtttgacgggccccgcaaacatcctcgttgttcctgcgcgtcattcggcg
tcgatatccgtaaagctcatgcaggaaatggcgggcgctacggtgattggtccgattttg
acaggcgtggataagccgattcaggtttgctcaactgtttccacagtaaatgacattttg
aacatggcgatcttggcggcttgcaaagttggtcagtcatga

DBGET integrated database retrieval system