KEGG   Cucurbita maxima (winter squash): 111468397Help
Entry
111468397         CDS       T05246                                 

Definition
(RefSeq) nuclear-pore anchor isoform X1
  KO
K09291  nucleoprotein TPR
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    111468397
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cmax03019]
    111468397
Messenger RNA biogenesis [BR:cmax03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     111468397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_MLP1_2
Motif
Other DBs
NCBI-GeneID: 111468397
NCBI-ProteinID: XP_022969370
LinkDB All DBs
Position
Unknown
AA seq 2074 aa AA seqDB search
MAHLFISDEEFSRHSNDAAFIAEKADAFIQGLYSELETVRAQADAASITAEQTCSLLDQK
FLSLSAEFSDLQSQNAQLQTTLELRLSELAEVKSQTHQLNLLSIGKDGEIERLNTELSEL
HKSKRQLMELIEHKDLEIGEKDSTIKSYLDKIVNLSETAAQREARISEIDMELVRSRAEL
AHLSQEKELVERHNAWLNDELTAKVGSIIEMRRLHSDTEAEMSAKLRDVERQLDECSSTL
KWNKDSVKELEMKLTSAQEELCSSRKLAAENEERLCAEISTVNKLVELYKESSEEWSKKA
TELEGVIKALETHLNQVESDYKEKLVKEESERNRLEEVAADLKVKLEKCEAEIELSRKKN
ELTLCPISSFAPDVLINPKESCDVVDDYHKFEPRVPVGVSGTALAASLLRDGWSLAKMYA
KYQETVDALRHEQMGRKEAEAVLQRVLCELEDKAEVILEERAEHEGMIESYSLLNQKLQH
SISEQAILEKSVQELKAVLKRHERDYMLIQRENVDLSRQVTILLKECRDVQLRCGSAGHD
VLENLSTATSFQINVESDADRVISEYLQLTFKDINGLVEQNVQLRSLVRKLSVQLQDTEL
DFKEKLEAELKSKTQEAASRVEAVLQKVEEQGQMIESLHASVAMYKRLYEEEQKRSLPHS
HSAGVALADFCRKELKFVSEDSQEDTKAALDQASKRVRSLEEELEKSRSEINLVRAERNK
FELESGFAKEKLASFMKEFEQQRVEMNGVLARNVEFSQLLVDYQGKLRKVSESLHSADEQ
SRKLSIEVSILKSEKELLSNAEKRAHDEIRNLSERLFRVQASLDTIRSVEEVHEEARVVE
RRKLEEHAKQLEREWAEAKKELQEERDNVRTLTLDREKTLKNAMSHVEDMGKELANALHA
TAAAEARAAVAEAKLFDLEKKISSSANQVIELDDRSGLKSHPSNQVGIDLHRTEAEIKKF
KEEAQACKEHMLQYKSIAQVNEEAVKQMECAHESFKIEAEKMKKSLEVELLQLRERVAEL
ENESILKSQEIASAARLKEEAIASSLADVRNLNEENAAKTSKILEMEIQISYLKEDLERE
QQKWRTAQANYERQVILQSETIQELTKTSQALASLQEEAAELRKLADAYKTENEELKAKW
EGGKVALEDFKNKADKAYNELNEQNKILHAKLEAFHIRLAEKDQKLAGVSSELNTEMVGD
SGMQSVVSYLRRTKEIAEVEISLLKKDKLRLQSQLESALKAVESAQTSLNAERQSSKALL
LTEEEIKSLQLQVREMNLLRESNIQLREENKHNFEECQKLREEFRKAKSETENFESMLKM
RQVEVEACKMEIESQKVEKAHLESRVSELLEKSKNIDYEDYNRVKDDVQRMQMELNEKDA
EIAKIKMLITERQESISQLEQDLSSCRFELKEREKKLNDVQHIEANLRTDMEKQKKFFSQ
FKRKLEIVSKEKDELGKENQALLRQLEDIKQVNVFGKRSTGDSTGEQTIEEKDTKIQILE
KHLERLREELKREKEDSRTEKSRRLKIEKAIKDSYTIVEQEKSKILNDLEKHKGNLKQAS
DELEKLRQSKSNLSEDALPQPLSGIGLDDLASTYVLAAENFEKTVQSVLTDLGAQNATSE
VSLVTDALVQSSTGPDVPLQTPDVAVPVAPVTTNFPVKILEEREKKGQLSKAKVETRKAG
RKLVRPRLGKPGGSLGDIDMSTSELPNSESKRATSGKSETESESTTSAHQLARKRVATAS
ELHEHAVIPGESITEMAAPVMKKAKGSDTLADDVGGPSSTSLESLKTQSPLEEVPDVCEF
PHGSSEDAADVEKEVEIAGEKADRPKELSSDGSISHEEIHTDRMDENLDKQIVAVSDDGL
KDQAEPDNWHLTSEIGSEREEGEVAPEVMELEGANNVESIEIGDDHIEPVATPDASPSRV
DDDAMAVTDMEIGEINSPEIQNEEKNDEGDAAEETSEILDKPTDSNQIDMESDQAVETTS
VATENVSSTPPEINDSKQGSPIVAKRSSPVGSSTSTTINLQERAKERAMLRQAGVVSSLD
RRPVRGLRGRGGRIERGGRGQRSGRGPPGESGRS
NT seq 6225 nt NT seq  +upstreamnt  +downstreamnt
atggcccacttattcatctccgacgaggagttctctcggcactccaacgacgctgctttt
attgccgagaaggccgatgccttcatccaaggtctctatagcgagctcgagaccgtcaga
gcccaagctgatgctgcttcaatcactgcggagcagacttgttctcttcttgatcagaag
ttcctctctctttccgctgagttctctgacctccagtctcaaaatgcacaacttcaaacg
accctcgaacttagactctccgagcttgccgaagtcaagtcccaaacgcatcagcttaat
ctactttccattgggaaggatggggagatagagaggttaaatacagagttatctgagttg
cataaatcaaaaaggcagttgatggagcttattgagcacaaggacttggaaattggtgaa
aaagattccactataaagagttatcttgataagattgtcaatttgtctgagacagctgct
caaagagaagctcgtatcagtgagatcgacatggagttggtgcgctcccgggctgaattg
gctcatctttcacaggagaaagaacttgttgagaggcataatgcgtggcttaatgacgag
ttaactgctaaagtaggcagtatcatagaaatgcgtaggcttcattctgatactgaggct
gaaatgtctgccaaacttagagatgttgagagacagttggatgaatgctctagcacctta
aaatggaacaaggatagtgtgaaagaacttgagatgaagctaacatctgcacaggaggaa
ttgtgttcgtcaagaaaacttgctgcagaaaatgaggaacgtctttgtgctgaaatatca
acagtcaataagcttgtcgaactttacaaagaaagttctgaggagtggtctaagaaggca
acagaactcgagggtgtcataaaagccttggagacacacttgaaccaagttgagagtgat
tataaggagaagcttgtaaaggaagaatctgaaagaaatcgtttggaagaggtggctgca
gatttgaaagtgaaactggaaaagtgtgaagcagagattgaacttagtaggaaaaagaac
gaactcactctttgtcccatcagcagctttgctccagatgttttgataaatccgaaggaa
agttgtgatgtggttgatgactatcacaaattcgaacccagggtacctgtaggtgtttct
gggacagctttagcggcttcacttttgcgtgatggttggagtttggccaaaatgtatgcc
aagtaccaagagactgttgatgctttgcggcatgagcagatgggaaggaaagaagctgag
gcagttctgcagagggtgctatgtgaattagaggataaagcagaagtcattttagaggaa
agagcggaacatgagggaatgatcgagtcatattccttgttaaaccaaaaattgcagcat
tctatttctgaacaggcaattttggagaaatctgttcaagaattgaaggctgttttgaag
agacatgaacgtgattacatgttaattcagagagagaacgttgacctttcaagacaggtt
acaattcttctaaaggaatgtcgagacgtacaacttcgctgtggatctgctggacatgat
gttcttgagaatctttcaacagctacatcctttcaaatcaatgtggagtctgatgccgat
agagttatatctgaatatcttcagttaaccttcaaggacataaatggattagttgaacag
aatgtccagctgagaagcctcgtacgtaaactttctgtgcagcttcaagatacagagctt
gatttcaaggagaaactggaggctgaactgaaaagtaaaactcaagaagctgcatctaga
gttgaagcagtgttgcaaaaagttgaagagcagggacagatgattgagtcccttcatgcc
tccgttgccatgtacaaaaggctgtatgaagaggagcagaagcgtagtttgcctcactcc
cactctgctggagttgctctagcagatttttgtaggaaggaactcaagtttgtttctgaa
gattctcaggaagacacaaaggctgctctggaccaggcttctaaacgagtaagatctctc
gaggaagagcttgaaaaatctagaagcgagataaatttagtaagggctgaacgtaacaag
tttgaactcgagtcaggttttgccaaagaaaaactggctagtttcatgaaggaatttgaa
caacagagagtggaaatgaatggtgtgttggctcgcaatgtggagttctcgcaactctta
gtggactaccaaggaaaactgcggaaagtttcagaatccttgcacagtgctgatgaacag
tcccggaaattgagtattgaggtgtccatcttaaagtctgaaaaggagttgttatcaaat
gctgaaaagagagcacatgatgaaatacgaaatttatctgaaagattattccgcgtgcag
gcttctctggataccattcgaagtgttgaagaagttcatgaggaggctagggttgtagaa
aggaggaaactggaggaacatgctaagcaacttgagagggaatgggcagaggcaaagaaa
gagttgcaagaagaaagggacaatgttcgaactctcactcttgatcgtgagaagacttta
aagaatgcgatgagtcatgttgaggacatgggaaaggaactagcaaacgcactacatgcc
actgctgctgctgaggcgagagctgccgtcgctgaggccaaactgttcgatctggagaag
aaaattagttcttcagctaaccaggtcattgagctggatgataggagtggacttaagtct
cacccttcaaatcaggttggcatagatttgcatagaacggaggcagagattaagaaattt
aaagaagaagcacaagcttgtaaagaacatatgctacagtacaagagcattgcacaggta
aatgaagaagctgtgaaacagatggaatgtgctcatgaatctttcaagattgaggctgag
aaaatgaagaaatctttggaagtcgaacttcttcagcttagagagagggttgctgaactt
gaaaatgaatctattttaaaatctcaagaaatagcttctgctgctagattgaaggaagag
gctattgcatcttccctggcagatgttagaaatctgaatgaagaaaatgctgcaaaaacg
tctaagattctggaaatggaaattcagatatcctatttaaaagaagacttggaaagggaa
cagcaaaaatggcgtactgctcaagctaattacgaaagacaggttattctccagtcagag
acgattcaggagctgacaaaaacatcacaagctttggcttctttacaagaggaagcagct
gagcttcgtaaattagctgatgcttacaaaacagaaaatgaagaactgaaggccaagtgg
gaaggtgggaaagtagcacttgaggattttaagaataaagctgacaaggcatacaatgaa
ctcaatgaacagaataaaattctgcatgctaaacttgaggcattccacattcgattggcg
gagaaagatcaaaagttggctggagtttcttccgaacttaatactgagatggttggggat
tctggtatgcagagtgtggttagttacctcagacggacaaaagaaattgctgaagtagag
atctccttgctaaagaaggacaagttgagattgcagtcacaattagaaagtgctcttaaa
gctgtggagagtgcacaaacttcacttaatgctgagcgtcaaagctcaaaagcattattg
ttaaccgaggaggaaattaaatctttgcaacttcaggttagggagatgaacttgcttcgt
gaaagcaatatccaactgcgagaagagaataagcacaattttgaggaatgccagaaacta
cgtgaagaatttagaaaggctaaaagtgaaacagagaactttgagagcatgctgaagatg
agacaagtggaggtggaagcctgcaaaatggagattgaatcgcagaaagtggagaaggct
catcttgaaagcagagtctctgagttgcttgaaaaatctaagaatatagattatgaagat
tataatcgtgtgaaggatgatgttcaaagaatgcagatggagctgaatgagaaagatgca
gaaattgcaaaaatcaaaatgcttatcactgaaagacaggaatcgatatctcaattggag
caagacctttctagttgcagatttgaactgaaggaaagggaaaagaaactgaatgatgtt
caacatattgaggccaatctgaggacagatatggagaaacagaagaaattcttttctcag
tttaagcgaaagcttgaaattgtctcaaaggaaaaggatgaattgggcaaagaaaatcaa
gctcttttgaggcagttggaagacattaaacaagtgaatgttttcgggaaaaggtccact
ggagattcaactggtgagcagaccatagaagaaaaggacactaaaattcagatacttgag
aaacatctggagcggctgagagaagaactaaaaagagagaaggaagatagtcgtacagag
aaaagcagacggttgaaaattgagaaggcaataaaggattcttatactatcgttgagcag
gaaaaatcaaagatcttaaatgatttggagaagcataagggaaacttgaagcaagcttct
gatgaacttgagaagcttagacaatctaaaagcaatctttcggaggatgctttacctcag
ccactttcagggattggcttggacgatcttgcttctacctacgttttagctgctgagaat
tttgagaagactgtgcagtcagttttgactgatcttggagctcagaatgctacttcagag
gtttctttggtcacagatgctttggtacaaagtagtacaggtcctgatgttcctctccaa
acgcctgatgttgcagtgcctgtggctcctgtaacaaccaactttcctgtcaaaatccta
gaagaacgggaaaagaaaggtcaattatccaaggcaaaagtagaaacgcgtaaagcaggg
cgaaagttggttcgacctcgtcttggaaaaccaggagggtctctgggtgatatagacatg
tcaacatcagaattaccaaacagtgaaagcaagcgtgcaacttctggaaaatcagaaact
gaaagtgaatctactacatcagcccatcagctggctcgcaagcgtgtagcgacagcttct
gaattgcatgaacatgcagttatccctggggagagcattactgaaatggcagctcctgtc
atgaagaaggctaaagggtcagataccttggctgatgacgttggtggaccatcttctacc
tctctggaaagtctcaaaactcagtcgcccttggaagaagttcctgatgtttgtgagttt
cctcatggttcaagtgaggatgcagctgatgttgaaaaagaggttgaaattgcaggggag
aaggctgataggccaaaagaactatcatctgatggatctatcagccatgaggagatacac
actgacaggatggatgaaaatctggataagcagattgtagcggtgtcagatgatgggtta
aaagatcaagctgaaccagacaactggcatctaacttcagagattggaagcgagagagag
gaaggtgaggtggcccctgaagttatggaactggagggtgccaataatgttgaaagcatt
gaaataggggacgatcatattgagccagttgcaacgcctgatgcctccccatctagagtt
gatgatgatgcgatggctgtcacagacatggagattggcgagataaactcccctgagatt
caaaatgaagaaaagaatgatgagggtgatgcagctgaggaaacttccgaaattttagat
aagccaactgatagtaaccagattgatatggagagtgatcaggctgttgaaaccacctca
gtagctaccgagaacgtttcgagtacgccgccagaaataaatgattcgaaacaaggtagc
cccattgttgctaaacggtcgtctcctgtcggtagtagcacgtctactacaataaatttg
caagagcgagccaaggaaagagctatgctgagacaggctggagttgtttcttcattggat
agacgccctgtgagaggattgcgtggccggggtggtcggatagagcgaggtggccgtggt
caacgatctggacggggaccacctggggaatcaggtaggagttaa

DBGET integrated database retrieval system