Cucurbita maxima (winter squash): 111470228 Help Entry 111470228         CDS       T05246                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism cmax  Cucurbita maxima (winter squash) Pathway cmax03083   Polycomb repressive complex cmax04120   Ubiquitin mediated proteolysis cmax04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cmax00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111470228    04120 Ubiquitin mediated proteolysis     111470228   09126 Chromosome    03083 Polycomb repressive complex     111470228  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmax04131]     111470228    04121 Ubiquitin system [BR:cmax04121]     111470228    03036 Chromosome and associated proteins [BR:cmax03036]     111470228 Membrane trafficking [BR:cmax04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     111470228 Ubiquitin system [BR:cmax04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    SCF complex     Adaptor protein      111470228    Cul7 complex      111470228 Chromosome and associated proteins [BR:cmax03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      111470228   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      111470228 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  111470228 NCBI-ProteinID:  XP_022971540 UniProt:  A0A6J1I611 LinkDB All DBs Position Unknown AA seq 155 aa AA seqDB search MSSAKRIVLKSSDGDTFEVDEAAALQSQAIRHMIEDDCADNVIPLPNVTSKILAKVIEYC RKHVDASSSDPPLSEQDLSAWDRDFADVDQATLFDLLLAANYLSINSLLDLTCRTVANMF RGKTPEEVRKTFNIKNDFTPEEEAEIRRENQWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcctctgccaagaggatcgttctcaagagctccgatggcgacacttttgaagtcgac gaggcggccgccctccagtcacaggccatccgccacatgatcgaggacgattgtgccgat aacgtcatccctcttccaaatgtcaccagcaagatcctcgccaaggttatcgagtactgc cgcaagcacgtcgatgcttcctcctccgatcctcctctctctgaacaagatctcagtgcc tgggaccgggacttcgccgatgttgatcaggccacacttttcgatctccttctggctgca aattatctgagcatcaatagcttgttagacctgacatgccgaacagtagctaacatgttc aggggaaagactccagaggaggtcagaaagaccttcaacatcaaaaatgacttcacaccg gaggaagaggcggaaattcgtagggagaatcagtgggcttttgaatga

DBGET integrated database retrieval system