KEGG   Callorhinchus milii (elephant shark): 103178167
Entry
103178167         CDS       T03088                                 

Gene name
pdgfra
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk04010  MAPK signaling pathway
cmk04020  Calcium signaling pathway
cmk04144  Endocytosis
cmk04510  Focal adhesion
cmk04540  Gap junction
cmk04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103178167 (pdgfra)
   04020 Calcium signaling pathway
    103178167 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103178167 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103178167 (pdgfra)
   04540 Gap junction
    103178167 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103178167 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cmk01001]
    103178167 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cmk04090]
    103178167 (pdgfra)
Enzymes [BR:cmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103178167 (pdgfra)
Protein kinases [BR:cmk01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   103178167 (pdgfra)
CD molecules [BR:cmk04090]
 Proteins
  103178167 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set C1-set LAT Adeno_E3_CR1
Other DBs
NCBI-GeneID: 103178167
NCBI-ProteinID: XP_007890945
UniProt: A0A4W3INV8
LinkDB
Position
Un
AA seq 1096 aa
MNIFLKILLILDCVFLGVFKGPQVATCQSFPDIYPNKAEIIVKLHTSFSLKCSGDNEVDW
ELPFPTDFVTDVKKKSEENNSGQFVKSLDIENAMGTFTGRYICYYTGKQDDYDDILGRDI
YVFIPDPEHPFVPQHMFEHVVMAAFGDVVLIPCRASDPEIQATLFNIENNSTVFGIYDHK
QGFSGHFQEGTYTCTTTVNGVKYESQEYILHTFRVAETLEVEIEAPKTVVKVGEPISVTC
MVMDNEVVDIEWNYPGKDKRTIAIQTLRETRIPNLKIMKTLLIENASLEDSGVYECSVEH
ATQFTNQLRKVRISVNDKGFIHLNPHFGTQEFANLHEVKQFVVDIEAYPKPTVRWLKNNV
TLHEENNEVITNLADVQETKYQSNLTLIRAKEQDSGAYTIVVDNIDNMTTYTFDLQVKVP
AKIIDLRDVHHGSANGQIVSCFVDGTPSPEVEWLICTDLKKCANDSMLWNVLLNNSSDIS
IETFETKEHHVESKLTFQKIDNTVAVRCVAKNELAAVAREVKLVSHNLHSELTVAAAVLV
LLVIVIISLIVLVVVWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDTRWEFPREGL
VLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGP
HLNIVNLLGACTKTGPIYIITEYCFYGDLVNYLHKNRDNFVSRYFEKGMKEKDIFGINPA
DESTRSYVILSFENNGDYMDMKQAESTQYVPMLERKDSSKYSDIQQSVYDHPPSHKKSLT
ESTELWNPLLDDNSDGISFMDLISFTFQVARGMEFLASKNCVHRDLAARNVLLAQGRIVK
ICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSFGILLWEIFSLGG
TPYPGMMVDSNFYNKIKSGYRMTKPEHATSDVYDLMVNCWNSEPEKRPSFTRLAEIVGNL
LPEDFKKSYEQVNNDFLKSDHPAVARMRVESDDTYIGISYTNEDKKKDRESGIDDQRLSA
DSGYIIPLPDIDPITDDSETASIRNRHSSQTSEESAIETGSSSSTFIKREEETIEDVEMM
DDVGIDPSDLAEDSFL
NT seq 3291 nt   +upstreamnt  +downstreamnt
atgaacatcttcttgaagatacttttgatcttggattgtgtctttctaggggttttcaaa
ggaccccaggttgctacctgccagagttttccagatatttatcccaacaaggcagaaata
atcgtcaagcttcatacgtcattcagcttgaagtgttcaggagacaatgaagtggactgg
gagctgccattccccactgattttgttacagatgtcaagaaaaagagtgaagagaataac
agtgggcagtttgtgaaatcacttgacatcgagaatgcaatgggcacatttactgggagg
tacatttgctattatactggaaaacaagatgactacgacgatattctgggccgggacatc
tatgttttcattccagatccagaacatccgtttgtcccacaacacatgtttgaacatgta
gtgatggctgcatttggtgacgttgtgcttattccatgtcgtgcatctgatccagagatc
caggccaccctgtttaacatagagaataacagcacagtctttggcatttatgaccataag
caaggattctccggtcatttccaagagggaacctatacctgcaccacaacagttaatgga
gtgaagtatgaatcacaagaatatattcttcatacatttagagtggctgagacccttgag
gttgaaatagaagctcctaaaacagtagtgaaagtgggtgaacctatttctgtgacctgc
atggtaatggataatgaagtggtggatatagaatggaattatccaggaaaagataaaagg
actattgccattcaaacacttcgtgaaacaagaataccaaacttaaaaattatgaagacc
ctgctcattgagaatgccagtctggaagattctggagtttatgaatgttctgtggaacat
gcaacccaatttaccaatcaattgaggaaagttcgcatctctgtcaatgataaaggtttc
atccacttgaatcctcacttcggaacacaagagtttgcaaatctgcatgaagttaagcag
tttgtggtggacattgaagcttacccaaaacctactgtacggtggttaaaaaacaatgtc
acactgcatgaagagaacaatgaggtgataaccaacttggcggatgtgcaggaaaccaag
tatcaaagcaatctgactctgatccgtgcaaaagaacaagatagtggagcttacaccatt
gtagttgacaatatcgataacatgaccacttatacctttgatttacaggttaaagtgcca
gctaagatcattgaccttcgcgatgtccaccacggctctgccaatggccagatagtttcc
tgctttgttgatgggacaccaagtccagaggtcgaatggctcatttgcacggatttaaaa
aagtgtgcaaatgatagcatgctctggaacgtgctgctcaataactctagcgacatcagc
atcgagacatttgagacgaaagagcaccatgtggagagcaagttgacctttcagaaaatc
gataacacagtggccgtgcgttgcgttgccaagaatgagcttgcagccgtcgcgcgtgaa
gtcaaactggtctctcataatctacattctgaactaacggtggctgcagcagttctggtg
ctgttagttattgtgatcatttctctgatagtccttgtcgtcgtttggaaacagaaacca
agatatgagatacgatggagagtaattgaatctatcagccctgatggacatgaatacatt
tatgttgaccccatgcaacttccctatgatacaagatgggaatttcccagagagggtctt
gtccttggtcgaattcttgggtctggggcctttgggaaggtagttgaaggaactgcctat
ggcttgagtcgctcacagcctgtcatgaaggttgctgtgaaaatgttgaaacccacagct
cgatctagtgagaagcaggcactaatgtctgaattgaagataatgacccatctcggacca
catttaaacattgtcaatctgctgggagcctgtactaaaacaggtccaatctacataatt
actgaatactgtttctatggagacctggtaaactacctacataagaacagagacaacttt
gtcagccggtactttgaaaaaggcatgaaggaaaaggacatttttggtattaaccctgct
gatgaaagcacaagaagctatgtgattctgtcgtttgagaacaatggcgactacatggac
atgaagcaagctgaaagcacccagtatgtgccaatgttggaaagaaaagacagttcaaaa
tattctgacatacagcagtcagtgtatgatcacccaccatcacacaagaagtcactaaca
gagtcaactgagctttggaacccacttttagatgacaactcagatgggatcagcttcatg
gatctaattagcttcactttccaggttgcacgaggaatggagtttctggcttctaaaaac
tgcgtgcatcgggatctggcagcccgcaatgtactcctcgcacaaggaaggattgtgaaa
atctgtgactttgggctggcaagagacatcatgcatgactccaactatgtctctaaaggc
agcaccttcctaccagtgaagtggatggctcctgaaagcatattcgacaatctttacaca
accttaagtgacgtgtggtcttttggcattctcctgtgggaaatattctcgctgggtggc
accccatatccgggaatgatggtggactccaacttctacaacaagataaagagtggctac
cggatgacgaaaccagaacatgcgacttccgatgtctatgacctcatggtgaattgttgg
aacagtgagcctgagaagagaccttccttcactcgtctggcagaaattgttgggaaccta
ttaccggaggacttcaagaagagctacgagcaggtgaacaatgacttcctgaagagcgac
caccctgctgttgcgcggatgagggtggaatctgatgatacctacattggaatcagctac
accaacgaggataagaagaaggatcgggagagcggaatcgatgaccagagactaagcgcc
gacagtggttacatcatcccacttcctgacatcgaccccatcacagacgacagtgaaact
gcttcaataagaaaccgacacagttcccaaacttctgaagaaagcgcaatcgagacaggc
tccagcagctcgacttttataaagcgagaggaagaaactatagaggatgtggaaatgatg
gatgatgtaggaatcgacccctcagaccttgcggaagacagctttctgtaa

DBGET integrated database retrieval system