KEGG   Callorhinchus milii (elephant shark): 103179846
Entry
103179846         CDS       T03088                                 

Gene name
kitlg
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk04010  MAPK signaling pathway
cmk04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:cmk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103179846 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103179846 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cmk04052]
    103179846 (kitlg)
Cytokines and growth factors [BR:cmk04052]
 Growth factors
  Growth factors (RTK binding)
   103179846 (kitlg)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 103179846
NCBI-ProteinID: XP_007893507
LinkDB
Position
Un
AA seq 325 aa
MGERFQTLINSIIYLQLFLTTLFGENICQKGNPVTDDIKDIDKLVGNLPSDYSIEINFFP
KIANANDSCWMYLTVPEMSLSLDSLLRKFAENSSNYLIIKKLQRIMDGIYSCLVAASKDL
EEMDYDCESSSRKPTDYFDYFREIVNTFQRADNNCPCDSEVVCSRIDPTTPGRGSNSTAH
VLEQSNKTRASKCERIHPELARPGRAKRHILTASEHGGQLAHSTSAEQSSVGSFQRKEDP
TTEIPFSIDSESRIEDPGCRTSVKYLIVVIVTILSTVSLSVPLTCLAVRLKQRRRNRENQ
SQPEERREENEVQTQFMCEPAQSMT
NT seq 978 nt   +upstreamnt  +downstreamnt
atgggcgaaagatttcagactttaataaacagcattatctacttgcagttgtttctgacc
accttatttggagaaaatatatgccaaaaaggaaacccagtgactgatgatataaaagat
attgataaattggttggaaatttaccaagtgattattcaatcgagatcaatttttttcca
aaaatagcaaatgcgaatgactcatgctggatgtatttgacagtacctgaaatgtcactt
agcctggatagccttttgcgaaagtttgcagaaaactcatcaaattatttaattatcaaa
aaactccaacggattatggatggaatttacagttgcctggttgcagcaagcaaggatttg
gaagaaatggactatgattgtgaaagttccagccgtaaaccaacagattactttgattac
tttcgtgaaattgtcaacacatttcaaagagcagataacaactgcccatgtgattctgag
gttgtctgcagcagaatagacccaacaaccccagggcgtggctcaaactccactgcacat
gtactggagcagagtaataaaacccgtgcgtccaagtgtgaacgcatacatccggagctg
gctaggccgggccgtgcaaaaagacacattctcacagccagtgaacatggcggccaactt
gcacacagcacatcagctgaacagtcctcagttggttcttttcagcgtaaagaagaccca
acaacagaaatccctttttcaattgattcagagagcagaattgaagatcctggatgtcgt
acatcagtgaaataccttatcgtggttatagtcaccattctttccactgtgagtctctct
gtgcctctaacatgtctggcagttagactgaagcaaaggagaagaaacagagagaatcaa
agccaaccagaggaaagaagggaggaaaatgaagtgcaaacccagtttatgtgtgaacct
gcacaatccatgacataa

DBGET integrated database retrieval system