Chamaesiphon minutus: Cha6605_0828 Help Entry Cha6605_0828      CDS       T02414                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cmp  Chamaesiphon minutus Pathway cmp01100   Metabolic pathways cmp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cmp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Cha6605_0828   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Cha6605_0828 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF1493 Ribosomal_L50 DraIII Motif Other DBs NCBI-ProteinID:  AFY92089 UniProt:  K9UCZ9 LinkDB All DBs Position complement(909027..909266) Genome browser AA seq 79 aa AA seqDB search MSADVLAKVQAVIADKLEVDATKITPEANFTDDLGADSLDVVELVMALEEEFDVEIPDEE AEKLQTVQSVVDYINAKHG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgcagatgtattggcgaaagtgcaagccgtaattgcagataaattggaagtagac gctaccaaaattacgccagaagccaactttaccgacgacttaggagccgactccctagat gtagtcgaactcgtcatggcattagaagaagaatttgatgtcgaaatccccgacgaggaa gccgaaaaactccaaaccgttcaatcagtagttgactacatcaacgccaaacacggctag

DBGET integrated database retrieval system