KEGG   Chelonia mydas (green sea turtle): 102936586Help
Entry
102936586         CDS       T02989                                 

Gene name
LSP1
Definition
(RefSeq) lymphocyte-specific protein 1
  KO
K14957  lymphocyte-specific protein 1
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:cmy00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102936586 (LSP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Caldesmon
Motif
Other DBs
NCBI-GeneID: 102936586
NCBI-ProteinID: XP_007063030
LinkDB All DBs
Position
Un
AA seq 400 aa AA seqDB search
MSDSEECHGDPESKNQEGEDPPTDTERLTAQWSVEDEEEAARERRRREREKQQRSQAEDG
LNNTDSLSESGLPVQENQFDFKPSGTSELEEDEGFSDWSQKLEQRKQRWAAEGTQEGEQT
CPREWTQAQEEAPTCIGERSPRHSYEEEDSGLREAEVKLEQVQLNQEGPEEGKKEEMRRE
PLETEEPQQLFEAECIQEQQEEEEEEEKAGQEEKKRRRNEEEETPEKRQKAPSTSSVEGE
EDEQCDGQSPASSTTITDRTESLTRSIKKSNSVKKTQPPLPVSKIDDRLEQYTHAIETSE
KVQKLVRQSSLELATTSMVVASTKNLWETGEVAAQSSVKSPSCKDIVAGDIVNKRSMWEQ
KGTPKNEGNIKTSGSGKKYKFVATGHGQYKKVLIDDATEQ
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcagactctgaggagtgccatggagaccccgagagcaagaatcaggagggggaagac
cccccgaccgacactgaaaggttgacagcacagtggagtgtggaggatgaggaagaggca
gcaagagagcgacgtagaagggaacgggagaaacagcagcggtcccaggcagaagatggc
ttgaacaacaccgactccttgtcagagagtgggctgccagtacaggaaaaccagtttgac
tttaagccctcagggacctcagagctggaagaggatgagggattcagcgactggtctcag
aagctcgagcagcgcaaacagaggtgggctgcagagggaacacaagagggggagcaaaca
tgccccagggaatggacacaggcccaggaagaagcgcctacttgcataggagaaaggtct
ccaagacactcctatgaggaagaggacagtggtctgagggaagctgaagtcaagctggag
caggtccagctgaatcaggaaggcccggaggaggggaagaaggaggaaatgaggagggag
ccgctggagacagaggagcctcagcaactttttgaggcagaatgcattcaagagcagcag
gaggaagaagaggaggaggagaaagctgggcaggaggagaaaaagaggaggaggaatgag
gaggaggagacgccagaaaaacgccagaaagcgccgagcacctccagcgtggaaggggaa
gaggatgaacaatgtgacggccagtccccagcgagttccacgacgatcacagaccgaact
gaatccctgacccgctccataaagaaaagcaacagcgtgaagaagactcagccaccactt
cctgtttccaagattgatgacagactggagcagtacactcatgccattgagacatccgag
aaggttcagaaacttgtccgacaatcttcccttgaacttgccaccacaagcatggttgta
gccagcacaaaaaacctctgggagactggagaggttgcagctcagtcctctgttaagtcg
ccatcctgtaaggatattgtggctggagatattgtgaataagcgaagcatgtgggaacag
aagggtacccccaaaaatgaaggcaacatcaagacctccggttctggcaagaagtacaag
tttgtagcgactggacatggccagtacaagaaggtgttgatagatgatgcaacggagcaa
tag

DBGET integrated database retrieval system