KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBH3980Help
Entry
CNBH3980          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb03030  DNA replication
cnb03410  Base excision repair
cnb03420  Nucleotide excision repair
cnb03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CNBH3980
   03410 Base excision repair
    CNBH3980
   03420 Nucleotide excision repair
    CNBH3980
   03430 Mismatch repair
    CNBH3980
Enzymes [BR:cnb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CNBH3980
    6.5.1.6  DNA ligase (ATP or NAD+)
     CNBH3980
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     CNBH3980
DNA replication proteins [BR:cnb03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    CNBH3980
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     CNBH3980
DNA repair and recombination proteins [BR:cnb03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CNBH3980
   NER (nucleotide excision repair)
    Other NER factors
     CNBH3980
   MMR (mismatch exicision repair)
    Other MMR factors
     CNBH3980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 4937926
NCBI-ProteinID: XP_773946
UniProt: F5H8W5
LinkDB All DBs
Position
8
AA seq 803 aa AA seqDB search
MSDIEYPVKSNIRKKRTVILSDDEDEGLGPSVIKEQVSSPKHSHLSDEETEPPRKVAKTS
SKVAPIFAPKEKKEKPSPKTSSALSKAPAKKIEVKSKGEKPLASIFTKATRKPEPKDDDE
MSDEVKQKGKDEEEEDEIYDEVEDKQEGEAAVKLASIFTKNQKSVPVADKGWKDGEAVPY
PALVSTFEKIEATTKRLEILEFLTQFLLVVAKRDTATDAKGSMLLKVVYLCINRLCPDYM
GIELGIGESLLIKAIAESTGRAMPKIKEDLKKEGDLGKVAMNSRNTQSTMFKPKPLTVPY
VFQCLTDIAKASGNASQAKKVGIIKKLLAACQGTEAKFIIRSLEGKLRIGLADKTVVVAL
AHAIVLKTIGDKKPPPEKLAIMLEQGAETVKAVYSELPSYDLVIPALLQGGVEGLRERCK
LTPGVPLKPMLAKPTKAITEVLDRFEGKEFTCEYKYDGERAQVHLLEDGTISVFSRNSEN
MSAKYPDLVDQIPRSMKPTAKTFVIDAEAVAYDLETKKILPFQDLSRRKRKDVKAEDITV
RVHIFAFDLLYLNGESLLAKELKERRQLLQEHFQPVESEFAFAKSSDGSTTEEIQALLEE
SVKDGCEGLMVKMLTSESSTYEPSRRSMNWLKLKKDYLSGVGDSLDLVVVGAYHGKGKRT
AVYGAFLLACYDPDSEHYQTICKIGTGFSEEILTQFYELLKPLELEVVRGDIEVGGAKPD
VWFEPRVVWEVLTADLSLSPIYAAAHGVIDSRGISLRFPRFIRIRDDKSADEATTAEQVS
EFYQRQISAGGKKGAGADVDDFW
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatagagtatccagttaagtctaatatcaggaaaaagaggacggttattctt
tcggatgacgaggacgaaggacttggtccatctgtgattaaggagcaagtctcgtctccc
aaacattctcatctatctgatgaagagacggagcctccccggaaagttgcaaaaacgtca
tccaaagtcgcgcctatctttgctcccaaagagaagaaagaaaaaccatctcccaagact
tcatcagctttatctaaagcacctgccaagaagatagaagtaaagagcaagggtgaaaaa
ccacttgcatcaatattcacaaaagccacacggaagcctgagcctaaggatgacgacgaa
atgtcggacgaggtgaaacaaaaggggaaagatgaggaagaggaggatgagatatatgat
gaagttgaggataagcaggagggagaggccgctgtcaaactggcctcaatctttaccaag
aatcaaaagtctgtccctgtggctgacaagggctggaaagacggcgaagctgtcccatat
cccgctcttgtatcaacgttcgaaaaaattgaggctacgactaagcgattagagatcctc
gaattcttaacccagtttttactcgttgttgccaagagagatacagccacagacgccaaa
gggtctatgctccttaaagtggtctatctttgtatcaacaggctatgccccgactatatg
ggtatcgaacttggtattggagaatcattattgatcaaggccattgcggagagcacaggg
cgggctatgcccaagatcaaagaagatttaaagaaggaaggagacctcggaaaggttgcc
atgaactctagaaacactcaatcaaccatgttcaaacccaaacctttgacagtaccatat
gttttccaatgtctcactgatatcgcaaaggctagcgggaacgcgtcacaagcaaagaaa
gtaggcattattaagaaactccttgctgcttgccaaggcaccgaggccaaatttatcatc
cgatccctcgaaggaaaattacgaatcggtcttgccgacaagacagtcgtggttgccttg
gctcacgctatcgtcctgaagacaattggtgacaaaaaaccgccacctgaaaaacttgct
atcatgctggaacagggcgctgagactgttaaagctgtctatagtgagcttccatcgtac
gacctggtaatccctgctcttctccaaggaggcgtagaaggtttgagagaacgctgtaaa
cttactccaggcgttcctctcaaacctatgcttgctaagccgacgaaagccatcacagag
gtccttgaccgtttcgaaggcaaggaattcacttgcgagtacaagtacgatggagaacgt
gcccaggtccacctgttggaagatggtaccatttctgtgtttagtagaaattcggaaaac
atgagtgccaagtatcccgatctggtggatcaaataccgaggtctatgaaacctactgcc
aagacgtttgtcatcgatgccgaagccgttgcttatgatttggaaaccaagaagattctt
cctttccaagacctgagtaggcgaaagcgaaaggacgtcaaggccgaggacatcacagtg
cgggtgcatatctttgcgttcgatttgctctatctcaatggagagagtcttctcgctaaa
gagcttaaagaaagacgacagctcctacaagagcatttccaacctgtggaatcggagttt
gcgtttgccaagtcatcagatggaagcacgacagaagagatccaggcattgctcgaagaa
agtgtgaaggatgggtgtgagggtttgatggtgaaaatgctcactagcgagtcatcaaca
tatgagcccagtagaagaagtatgaattggctcaagctcaagaaagactacctttcaggt
gttggagactctctcgatcttgttgtcgttggagcatatcatggcaaaggcaaacgtaca
gcagtctatggcgctttcctcctcgcgtgctatgatcccgattcggaacattatcagact
atctgcaagattggtaccggtttctccgaggaaatcctcacacaattctacgagttactt
aaacctttagaactggaagtcgtgagaggagatatagaggttggaggagccaaaccggat
gtatggtttgagcccagagtggtctgggaggtcttaacagccgatttgagtttaagtccg
atttacgcggcggcacatggtgtaatcgattctcgaggaatctcgctccgtttccctcgg
tttatcaggattagagacgacaagtctgctgacgaagccacaacggctgagcaggtcagc
gagttctatcaacgtcagatttcggcaggtggcaagaaaggggcgggggcggacgtggat
gacttctggtaa

DBGET integrated database retrieval system