KEGG   Cupriavidus necator N-1: CNE_2c07490Help
Entry
CNE_2c07490       CDS       T01564                                 

Gene name
bphA
Definition
(GenBank) biphenyl dioxygenase subunit alpha
  KO
K16319  anthranilate 1,2-dioxygenase large subunit [EC:1.14.12.1]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc00627  Aminobenzoate degradation
cnc01100  Metabolic pathways
cnc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cnc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CNE_2c07490 (bphA)
Enzymes [BR:cnc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     CNE_2c07490 (bphA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske Ring_hydroxyl_A
Motif
Other DBs
NCBI-ProteinID: AEI79721
UniProt: F8GS71
LinkDB All DBs
Position
2:complement(807678..808967)
Genome map
AA seq 429 aa AA seqDB search
MYQTQAVIQHTLGKKDAGLADCRWPEDSLHYIPDWVYTSKEVHDLELQKIFRGRSWNYVA
LEAEIPNAGDYKRSYVGATPVVVSRAEDGSVNVFENRCAHRGAEFCRHSQGNAKEFVCPY
HQWSYDLKGNLQGVPFKRGVNRAGGMPRDFRNEDHGLVKLNVATRNGVVFASYAADMESL
EDYLTPEILKDFDIVFNGKPLKVLGYYKNELPCNWKMYHENLKDPYHATLLHSFLVVFGL
LVAGNESAMIADPVHGRHGTMASAKKEDKYAAVSDENKKEMRSYHEGMRLEDERFLEYVK
EFDSPWSVTMQTIWPNLIVQREMNTLGVRQIVPNGPDSMLMLWTMFGYEDDTEEMTQHRL
RQGNLMGPAGFLGLEDNEAMKFVQEGVRRSSSDLNVLKLDPDQVGTSNSLISESAIRAMY
QYYRGVMGF
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtaccagacacaagcggtgatccagcacacgctgggcaagaaagacgccggcctggcc
gactgccgttggcccgaagacagcctgcactacatcccggactgggtctacaccagcaag
gaggtgcatgacctggagctgcagaagatctttcgcggacgctcctggaactacgtcgcg
ctcgaagcggagatccccaacgccggcgactacaagcgctcctatgtcggcgcgacgccc
gtggtggtgtcgcgcgccgaagacggctcggtcaacgtcttcgagaatcgctgcgcgcac
cgcggcgccgagttctgccgccacagccagggcaatgcgaaggaattcgtctgcccctat
caccaatggtcctacgacctcaagggcaacctgcagggcgttccgttcaagcgcggcgtc
aatcgtgcgggcggcatgcccagggacttccgcaacgaggaccacggcctggtcaagctg
aacgtggccacgcgcaacggcgtggtcttcgcctcgtacgcggcggacatggaaagcctg
gaagactatctgacgccggagatcctcaaggacttcgacatcgtcttcaacggcaagccg
ctcaaggtgctcgggtattacaagaacgaactcccgtgcaactggaagatgtaccacgag
aacctcaaggacccgtaccacgccacgctgctgcactccttcctggtggtgttcgggctg
ctggtggcgggcaatgaaagtgccatgatcgccgatccggtgcacgggcggcacggcacc
atggcgtcggcgaaaaaggaagacaagtacgcggccgtcagcgacgagaacaagaaggag
atgcgctcataccatgagggcatgcgcctggaagacgaacgcttcctggagtatgtgaaa
gagttcgattcgccgtggtcggtgacgatgcagacgatctggccgaacctgatcgtgcag
cgcgaaatgaacaccctcggcgtgcgccagatcgtgcccaacggccccgacagcatgctg
atgctgtggaccatgttcggctacgaggacgataccgaggagatgacgcagcaccgcctg
cgccagggcaacctgatgggccccgcaggcttcctggggctggaggacaacgaggcgatg
aagttcgtgcaggaaggcgtgcgccgctccagcagcgacctcaatgtgctcaagctggat
ccggaccaggtcggcacctccaactccctgatctccgaatccgccatccgtgcgatgtac
cagtactaccgcggcgtgatggggttctga

DBGET integrated database retrieval system