KEGG   Cryptococcus neoformans var. neoformans JEC21: CNG01360
Entry
CNG01360          CDS       T00243                                 

Definition
(RefSeq) hypothetical protein
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
SSDB
Other DBs
NCBI-GeneID: 3258836
NCBI-ProteinID: XP_024513190
LinkDB
Position
7:join(394407..394493,394547..394604,394654..395012,395063..395355,395404..396740,396788..397416)
AA seq 920 aa
MGPSGLVISKLGIQATASDTHVRGLICLKVSLPKESPGRPGARWVLFNSTPPALLSQPTI
HPLPLPLPSSQSPHLRIASTLLSLPHSTSYPPAPSQPSILGGKPYIDVSSTTGKVFVVVD
SLGGSGRRGSFKGKTDSNGSTERERKDWLITMEFQQALESSVEDDIYKVLLPIPRCLDNV
IRFQILSPSTSTSSMNQVSVLTEPKMLPLPASAFDSDPSPYGHDLINGNGKGVMREEGWE
DGEDLEDEDYENDDQGSSWLEGRFQSTDILRLEWSFTSTMIDSTIPSLSISPKWDKYRPS
MELNYTAVAPGSDTVVSLKVDVPEGWAWAELIIESEGLAYWKGVDGEFEDEEREDPDRTA
EYQDDDSFATVRPEQSGHLHRRSRSRQSILSSNAAAGPSTATYLPRTSGSGSSISLMRQT
LPTAGDAIDEFSFEMSSEQSPAPKRPNTPLGSRVSLLPTSKPSTPSKRVKQSVSLPVAKS
VKQGRLFDLYFYEHSDRAFSLRGMLVPISHLALVSQRLPCPIPLVNLPHNGSTQCNIQCN
NALYQDQTLPTSEPHLISIPSANAFFWSDDSVSNSKRDKESGKVKGDMRIRLRRDIWGVV
SMSMLFAFPSRGDEVGFILHPSTPNSNAHDNDIKGRTVRVTRASMNGQPIPRCLHRWQDG
KTEVRIGKKEGREDSGLVEIILEIVGQEFSLPTFEDAEGMGIVELCGEGWEVVKPIMQTT
LTPSPNDTYSYPLSTPCSISFQPPSAPQISTTSRARTLFSFSTFFNLFMLWLLLSMGSQI
QRLRNEVSYVAGEARDLRMYGYNPSSGGTGEDRGDECLDRTLRDGGVKGVKDESTVTLGL
THQIPLDESPSLSSSDKLVSEASPQPPSPHPTAPNALAPRQQRHLWAGWDRLVMHPTVKS
LTKGVAWLWHAVVWLVVPPI
NT seq 2763 nt   +upstreamnt  +downstreamnt
atgggaccctcgggactcgttatatcaaagctaggaatacaggctacagcttcagacact
catgttagaggacttatatgtctgaaggtatcgttgcctaaggaaagccctggaaggccg
ggagcaagatgggtgctattcaactcaacacctccagctctcttgtcccagccgaccatt
catcctctaccacttcctcttccctcttcgcagtcgccacaccttcgtattgcttcaaca
ttgctttcactcccacattctacgtcttacccacctgcaccttctcagccatctatcctt
ggaggcaaaccgtatatcgatgtgtcaagtacgaccgggaaggttttcgtagtggtagac
tcacttgggggtagcggaagaagaggaagcttcaaaggcaaaactgatagcaatgggagt
acagagcgggaaagaaaagattggttgattactatggagtttcaacaggccttggaaagt
agcgtggaagatgacatttacaaagtactcttgcctattccaagatgtctagacaatgtc
atccgctttcagattctctccccttccacctccacttcatctatgaaccaagtcagtgtt
ctgactgaaccaaaaatgctgcccttgccagcgtctgcttttgattctgatccatcccca
tatggacatgacttgatcaacgggaatgggaagggtgtgatgagagaggaaggttgggaa
gacggggaagatctggaagatgaggattatgagaatgatgatcaagggtctagctggttg
gagggaagattccagagcacggatattttgagactggaatggtcattcacatccactatg
attgactccaccattccatcactctcaatatcgcccaaatgggacaaatatcgaccttct
atggagctcaattatactgccgttgctcctggttcagatacagttgtttccctgaaagtc
gatgtccccgaaggatgggcgtgggctgaactgattatcgaaagtgagggattggcatat
tggaaaggtgtagatggagaatttgaagatgaggaaagggaagatcctgacaggactgca
gagtaccaggatgatgattcctttgctaccgtccgtcctgagcagtcaggacacctacac
cgacgcagtcgctcacggcaatctattctttcgtccaatgccgctgcaggaccatcgaca
gccacgtacctcccacgaacatctggctctggctcgtctattagtctcatgcggcagact
ttacccacggcaggcgatgctatcgatgaattctcctttgaaatgagcagtgaacaaagt
ccggctccgaagagacccaacacgcctctggggtcgagagtatcgctgttacctacctcc
aaaccatctaccccttccaaacgagttaagcagtcggtatccctaccagtggccaagtct
gtcaagcagggtagattattcgatttgtacttttacgaacacagcgacagagccttctcg
cttcgcgggatgcttgtaccaatctcccacctggccctcgttagccaacgccttccttgc
ccaatccctcttgtcaatcttccgcacaatggctcaacacaatgcaacatccagtgcaat
aatgctctctaccaggaccaaactcttcccacgtccgaacctcatttgatcagcataccc
tctgctaacgcctttttctggtccgatgattctgtatcgaatagtaagagagacaaagaa
agcgggaaggttaagggggatatgagaatcaggctacgcagagatatctggggggtcgtc
tctatgtctatgctcttcgccttccctagtcgaggtgacgaagttgggtttatcctccat
ccttcaactccaaatagcaatgcccacgacaatgacatcaaaggaaggacagtgagggta
actcgagcaagcatgaacggccagcccattccaaggtgtttacatagatggcaagacggc
aaaacggaggtgaggatcgggaagaaggaagggagggaggattcagggttggtagagatt
attttggaaattgtcgggcaagagttttcattgccgacttttgaggatgcggaagggatg
gggattgtggagctttgcggggagggttgggaagtggtgaaacccatcatgcagacaacg
cttacaccatcaccaaacgacacgtactcttatcccctttcaaccccgtgctcaatatct
ttccagccaccttctgccccacaaatctctacgacctcgcgtgctcgaacactcttctcc
ttctcaaccttttttaacctcttcatgctctggctcttattatcaatgggctcacaaatc
cagagattgagaaatgaagtttcttatgtcgcaggggaagcgagagatctgaggatgtat
ggctacaatccatcatcaggtgggacgggcgaggataggggggatgagtgcttggatagg
acactgagagatggtggggtaaagggagtgaaagacgagagtactgttaccttaggtttg
acacatcagattccccttgatgagtctccctcactttcctcttctgacaaacttgtgtca
gaggcatctccacaacctccgtcaccgcatcccacggcgcccaacgcactcgcgcctcgc
caacagcgccatttatgggctggatgggataggttagtgatgcatccgactgtgaagagt
ttgacgaagggtgtggcttggctatggcatgcggtggtatggctagttgtaccccctatc
taa

DBGET integrated database retrieval system