KEGG   Cryptococcus neoformans var. neoformans JEC21: CNG01410
Entry
CNG01410          CDS       T00243                                 

Definition
(RefSeq) hypothetical protein
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 3258635
NCBI-ProteinID: XP_571836
UniProt: Q5KE82
LinkDB
Position
7:complement(join(411474..411600,411655..411788,411834..411842,411905..412345,412400..412700,412775..412792,412848..412993,413058..413068,413131..413212))
AA seq 422 aa
MADSPSPLPPYNSVWTKRAAVADEWLRQHKVVVSATSASVISTFAGFPLDSLKSRLQSSR
EKVSIPRLATEVVREEGIGGLWRGFPLPLITISIVRTISFTIYSSTKRILNSTRLPSGPP
KSDHKLTDNGRSGSKDGSDEKGPWINIHLGWFSGDNAKDIGITSLLAGAASGAVVCVGSA
PFELVKVRRQLEYQIYRDSHPELFLNPSAATAGSGSKAAGVPRTPSFTPPTTLQAVKLIV
NSNGLRGLYTGWRLHFVRDTLGTALYFAEYDVMRYYLGRQKTKTREDGGGGFGHDVQGDL
PDWARAWLPRQAIPFLCGSVAGVSSWALIYPVDAIKTKAQQRALSGLTPRTPTEQFHRLV
RGTGKDSPKPLLSGIARLYRGLGISMIRSMLTHGLLWTLVDAVGSYIETKPCERYFGVDI
PL
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggcggacagtccatcaccgctgccaccatataatagcgtatggactaaacgagcagcc
gtcgcagatgagtggttacgccaacacaaagttgttgtttcggcaacgtcagcctctgtc
atttcgacctttgcaggcttccctctcgattctctcaagtcgcgactgcagtcatcacgc
gagaaggtatctatacctagactagcaaccgaagtcgttagagaagaaggtatcggagga
ctgtggagagggttccctttaccacttataacgatatcgattgtccgaacaatatctttt
actatttacagctcaaccaagcgtattcttaattctacacgtttacccagcggaccacca
aaatcggaccataaacttaccgataatggccgttccggtagcaaagatggaagcgacgag
aagggtccatggataaacatacatttaggatggttttcgggggataatgcgaaggatatc
gggatcacaagtcttttagcgggagctgctagtggggctgtagtctgtgtaggaagcgcg
ccatttgagcttgtcaaggttcgaagacaattagaataccagatctaccgtgattcccat
cccgagctctttctcaatccatctgcagccacggctggctccggctccaaagcagctggt
gtcccgcgcactccttcattcactcctccaacgacacttcaagcggtcaaactcatcgtt
aattccaatggcctacgcggcttgtacactggttggaggctccatttcgttcgcgatacg
ctaggaacagctctatactttgcagagtatgatgttatgcgctattatcttggccgacaa
aagacaaaaactagagaagacggaggaggaggatttggtcatgatgtgcagggagatttg
ccagattgggcaagagcttggttgccgaggcaggctataccgttcttgtgtggaagtgtg
gcgggagtttcgagttgggcgctgatatatcctgttgatgcgataaaaactaaggctcaa
cagagagctttgtcaggattaacgccgcgcacacctactgaacaatttcaccgcttagta
cgaggaacgggcaaggatagcccaaagccattattatctggtatcgcccgattgtaccga
ggacttgggatctcaatgatccgttcaatgctcacccacggactgttatggacgcttgtg
gatgctgtaggctcctacattgagacaaaaccttgcgaaaggtactttggagtcgacatt
cctttatag

DBGET integrated database retrieval system