KEGG   Cryptococcus neoformans var. neoformans JEC21: CNG01450
Entry
CNG01450          CDS       T00243                                 

Definition
(RefSeq) hypothetical protein
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
SSDB
Motif
Pfam: Ribosomal_S21 DUF1604
Other DBs
NCBI-GeneID: 3258887
NCBI-ProteinID: XP_571842
UniProt: Q5KE78
LinkDB
Position
7:join(420095..420640,420700..420747)
AA seq 197 aa
MSFLFRSTIRASTSRLPTSLPTPTPRPLAFLPLPLSRFNSSLSTPPSPSATKPSSPPQNP
INPKFAELTSSLSIPVSSTSKPHAAAAAADPTSEDWWMTLSKKSHYNTFSSTKGFHPTKY
FSGRSIELNRGTDFLVAYKRMQGVMRMGNMKKEAKLNEFHEKPSVRRRRLRSERHRRRFK
EMVRSKVQQALAMRSRA
NT seq 594 nt   +upstreamnt  +downstreamnt
atgtctttcctcttcagaagcaccattagggcatccacctccagacttcccaccagcctg
cccactcccactccccgccccctcgctttccttcccctcccgctttcacgtttcaactcc
tccctctcgactcctccatctccatccgctaccaaaccatcatcacctcctcaaaatcct
ataaaccccaaattcgcagagctcacctccagtctctccattcccgtatcctccacttct
aaacctcatgcggccgctgctgccgcagaccctacatccgaagattggtggatgaccctt
tccaaaaagtctcactacaatactttctcgtcgaccaagggtttccaccctacaaaatac
ttttccggaagatcgattgagttgaacaggggcacagactttttggtggcatacaagagg
atgcaaggagtgatgagaatggggaacatgaagaaggaagccaagctgaacgagtttcat
gaaaagcctagtgtgagaagaaggagattgaggagtgagaggcataggaggaggttcaag
gagatggtgaggtccaaggttcaacaagcgttggctatgaggagcagggcgtag

DBGET integrated database retrieval system