KEGG   Cryptococcus neoformans var. neoformans JEC21: CNG01470
Entry
CNG01470          CDS       T00243                                 

Definition
(RefSeq) hypothetical protein
  KO
K17770  mitochondrial import receptor subunit TOM20
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Brite
KEGG Orthology (KO) [BR:cne00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cne03029]
    CNG01470
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cne02000]
    CNG01470
Mitochondrial biogenesis [BR:cne03029]
 Mitochondrial protein import machinery
  Outer membrane
   Transporter outer membrane (TOM) complex
    CNG01470
Transporters [BR:cne02000]
 Other transporters
  Primary active transporters [TC:3]
   CNG01470
SSDB
Motif
Pfam: MAS20 PMC2NT Erythro_esteras
Other DBs
NCBI-GeneID: 3258767
NCBI-ProteinID: XP_571845
UniProt: Q5KE76
LinkDB
Position
7:join(423158..423284,423360..423430,423493..423688,423747..424003)
AA seq 216 aa
MASISPVKVAGTVAAVAVSGFLGYAVYFDYMRRHSPEFRKSLRKQHKKLSAVAEANAKAE
KEKNAKALRDGFLRIQTEAVPMTPDQQEGYFAEAANQGEQLIAQGEEHYVEAALHFFRAL
RVYGNPGELLAVYQRVVPPPVLDMIIQLIALSTSTATGAGAGARPTAASLETPAPAPASV
EDLDEEKPAKEDAPSPNSASQGSGAEWEKVNQEAQE
NT seq 651 nt   +upstreamnt  +downstreamnt
atggcctctatttctcccgtcaaggttgcgggcactgttgccgctgtcgctgttagcggt
ttcctcggttacgccgtctactttgattacatgcgacgacactctcccgagttcaggaaa
tctctccgaaagcagcataagaagctctctgctgttgctgaagccaatgctaaggccgag
aaggagaagaacgctaaggccctccgagacggctttctccgcattcagaccgaagctgtc
cccatgaccccagaccagcaagaaggttactttgccgaggctgccaaccagggtgaacag
ctcatcgctcaaggtgaggaacactacgtcgaggctgctttgcacttcttcagggctttg
agggtatacggtaacccaggagaattgcttgctgtctaccaacgagtcgtcccccctccc
gtcctcgacatgatcatccagcttatcgccctctctactagcaccgctactggagccggc
gccggggcaaggcccaccgctgcttccctcgagactcccgcccccgcccccgctagcgtt
gaggaccttgatgaagagaagcccgccaaggaagatgctcctagcccgaatagcgctagc
cagggtagcggtgccgagtgggagaaggtcaaccaggaggctcaggagtaa

DBGET integrated database retrieval system