KEGG   Cedecea neteri SSMD04: JT31_03360
Entry
JT31_03360        CDS       T03298                                 

Definition
(GenBank) multidrug transporter
  KO
K03327  multidrug resistance protein, MATE family
Organism
cnt  Cedecea neteri SSMD04
Brite
KEGG Orthology (KO) [BR:cnt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cnt02000]
    JT31_03360
Transporters [BR:cnt02000]
 Solute carrier family (SLC)
  SLC47: Multidrug and Toxin Extrusion (MATE) family
   JT31_03360
SSDB
Motif
Pfam: MatE Polysacc_synt_C AveC_like
Other DBs
NCBI-ProteinID: AIR03679
UniProt: A0A089PZJ5
LinkDB
Position
747934..749307
AA seq 457 aa
MQKYLTEARQLLALAIPVIIAQVAQTAMGFVDTVMAGGYSATDMAAVAIGTSIWLPAILF
GHGLLLALTPTVAQLNGSGRRERIAHQVRQGFWLAGMVSVLVMVVLWNAGYIIHAMHNID
PELADKAVRYLRALLWGAPGYLFFQVGRNQCEGLAKTKPGMVMGFIGLLVNIPVNYIFIY
GHFGMPELGGVGCGVATAAVYWVMFFSMLSYIKKARSMRDIKNPDDFSKPDWAVLKRLSQ
LGLPIALALFFEVTLFAVVALLVSPLGITDVAGHQIALNFSSLMFVLPLSLGAAVTIRVG
FRLGQGSTLDAQVAARTGVGVAICLAMCTALFTVTFREHIALLYNDNPAVVALAAHLMLL
AAIYQISDSIQVIGSGVLRGYKDTRSIFFITFIAYWVLGLPSGYVLALTDWVVEPMGPAG
FWIGFIVGLTSAAILMMLRMRWLQRQPSVTILQRAAR
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgcagaagtacctcaccgaagctcgccagctccttgccctggcgatacctgtcatcatc
gcgcaggtcgctcaaaccgcaatgggattcgtcgataccgtcatggccggtggctacagc
gctaccgacatggcggccgttgccatcggcacctctatctggctgcccgcaattctcttt
ggccacgggctgctattggccttaacgccaaccgtggcgcaacttaacggctcgggccga
cgcgagcgcattgcacaccaggttcgccagggattctggctggccggcatggtctccgtg
ctggtgatggtggtgctctggaacgcgggctatatcattcatgccatgcacaacatcgat
ccggaactggcggataaagccgtacgttacctgcgcgcgctgctttggggggcaccgggt
tatctgttcttccaggtaggacgtaaccagtgcgaaggcctggcaaaaaccaagcctggc
atggtgatgggctttattggcctgctggtgaacattccggttaactatatctttatttac
ggccatttcggcatgccggaattgggcggcgtgggctgcggtgtggcaacggcggcggtt
tactgggtgatgttcttcagcatgctttcctatatcaagaaagcccgctcgatgcgcgac
attaaaaacccggacgatttcagtaaaccggactgggcggtgcttaaacgtttaagccag
cttgggctgccgattgcgctggcgttattcttcgaagtgacgctgttcgccgtcgtcgcc
ctgcttgtgtctccactcggcattaccgacgttgccggccaccagattgcgcttaacttt
agctcgctgatgtttgtgttaccgctttcattaggcgcagcggtgaccatccgggttggc
ttccgccttggccagggctcaaccctggacgcgcaggtcgccgcccgcaccggcgttggc
gtggcgatttgcctggcgatgtgtacggcgctgtttaccgtcaccttccgcgagcacatc
gcactgctttataacgacaacccggcggttgtggcgctggctgcgcacctgatgctgctg
gcggcgatttatcaaatctccgactcgattcaggttatcggcagcggcgtgctgcgcggc
tataaagatacgcgttcgatcttctttatcacctttatcgcctattgggtgctcggtctg
ccgagcggctatgtgctggcgcttaccgactgggtggttgaaccgatggggccggcaggg
ttctggattggctttattgtcggcctgacctccgccgctattctgatgatgctgcgcatg
cgctggctgcaacgtcagccttccgtcactatcctgcagcgtgctgcacgttaa

DBGET integrated database retrieval system