KEGG   Cedecea neteri SSMD04: JT31_03690
Entry
JT31_03690        CDS       T03298                                 

Definition
(GenBank) histidine ammonia-lyase
  KO
K01745  histidine ammonia-lyase [EC:4.3.1.3]
Organism
cnt  Cedecea neteri SSMD04
Pathway
cnt00340  Histidine metabolism
cnt01100  Metabolic pathways
Module
cnt_M00045  Histidine degradation, histidine => N-formiminoglutamate => glutamate
Brite
KEGG Orthology (KO) [BR:cnt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    JT31_03690
Enzymes [BR:cnt01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.3  histidine ammonia-lyase
     JT31_03690
SSDB
Motif
Pfam: Lyase_aromatic
Other DBs
NCBI-ProteinID: AIR03739
UniProt: A0A089PZQ4
LinkDB
Position
complement(813048..814592)
AA seq 514 aa
MSTQKKLCSLTPGSVSLATLREIYHGNVLLRLDPGAVAAVERALGTVEAIVAHGDVVYGI
NTGFGKLAQTTIATDHLAELQRNLVLSHSVGLGEALPDDVVRLVMASKIISLSRGHSGVR
LLVIDSLIALFNAGVMPVIPEKGSVGASGDLAPLAHLSLMLLGEGNVRVNGEQIPAVDGL
KLAGVEPLVLGPKEGLALLNGTQVSTALALRGLFEGEKVFAAGLVAGALSLEAIKGSVKP
FDARIHQARGQAGQIDVAAAVTGLLADSKIVDSHVHCGRVQDPYSIRCVPQVMGACLDNL
RHAARVLQIEANAASDNPLVFSDTGEVISGGNFHAEPVAFAADIIALAVAEIGAISERRL
ALLLDTGLSGLPPFLVKEGGINSGFMIAQVTAAALASENKSLAHPGSVDSLPTSANQEDH
VSMATYAARRLGEMCFNTAAVVGIEAMAAAQGIEFHRPLRSSPLLEKVFGDIRERVAFLE
KDRLLAPDIEQMRLWGCSDGWPQVIVKLLPSSAA
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgtcaacgcaaaagaagctatgcagtctcactccaggttccgtttcactggccaccctg
cgcgaaatttatcacggcaacgtgttgctgaggctcgatcccggcgcggtcgccgccgtt
gagcgcgcgctgggtaccgtagaggctatcgttgcccacggtgacgtggtctatggcatt
aacactggttttggcaagctggcgcaaacgaccatcgccaccgatcaccttgccgaactc
cagcgtaatctggtgctttcccacagcgtcgggcttggtgaagctttgcctgatgacgtt
gttcgcctggtgatggccagcaaaattattagcctgtcacgcgggcattcgggcgttcgc
ctgctggtgattgacagccttattgcgctgttcaacgcgggcgtgatgccggtcatcccg
gagaaaggttccgtgggcgcctccggtgacctggccccgctggcgcatttgtcgctgatg
ctgctgggcgaggggaacgtaagggttaacggcgagcagatccctgccgtcgacgggctg
aagctggcgggcgttgagccgctggtgctggggccaaaagaaggcctggcgctgctgaac
gggacgcaggtttctacggcgcttgcgctgcggggcctgtttgaaggcgagaaggttttt
gctgccgggctggtggcgggggcgctgtcgctggaggcaatcaaaggttccgtgaagccg
tttgatgcgcgtatccaccaggctcgcggtcaggctggacaaattgatgtggcggcggcg
gtgaccgggctgcttgccgacagtaaaattgtagattctcacgtccactgcgggcgcgtt
caggacccatattctatccgctgcgttccccaggtgatgggcgcctgcctcgacaacctg
cgccatgccgcgcgtgtcctgcagatagaagccaacgcggcttcggataacccgctggta
ttcagcgacaccggagaggtgatttccggcggtaatttccacgcggagccggtcgccttt
gcggccgatatcatcgcgctggcggtggcagaaattggggctatttcagagcgtcgcctg
gcgctgctgctggataccgggctgtctggcctgccgccgttcctcgtgaaagagggcgga
attaactccggctttatgattgcccaggtcacggccgcggcgctggcctcagaaaataag
tcgctcgctcatccgggcagcgtcgacagcctgcccacgtcggctaatcaggaagatcac
gtttccatggcaacgtatgcggcacgccggctgggcgagatgtgctttaacaccgctgcg
gtggtgggtatagaggcgatggcggctgctcagggcattgaattccacaggccgctgcgc
agttccccgctgcttgaaaaggtcttcggggatattcgcgagcgcgtcgcgttcctggaa
aaagatcgcctgctggctccggatattgagcaaatgcgcctttggggctgcagcgacggc
tggccgcaggttatcgtgaagcttctgccttcttcggcggcgtaa

DBGET integrated database retrieval system