KEGG   Cohnella candidum: EAV92_04605Help
Entry
EAV92_04605       CDS       T05696                                 

Gene name
pknB
Definition
(GenBank) Stk1 family PASTA domain-containing Ser/Thr kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
coh  Cohnella candidum
Brite
KEGG Orthology (KO) [BR:coh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:coh01001]
    EAV92_04605 (pknB)
Enzymes [BR:coh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     EAV92_04605 (pknB)
Protein kinases [BR:coh01001]
 Serine/threonine kinases: Other
  Bacterial family
   EAV92_04605 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like Kdo RIO1 Haspin_kinase Ig_3 KIND FTA2
Motif
Other DBs
NCBI-ProteinID: AYQ71906
UniProt: A0A3G3JUK2
LinkDB All DBs
Position
1004155..1006227
Genome map
AA seq 690 aa AA seqDB search
MIGQTLGNRYELLARVGGGGMALVYKARDNLLNRYVAVKVLRQQFMHDEDFIRRFRREAQ
AAASLSHPNIVSIYDVGQEEDTHYIVMEFVDGANLNEIIRERAPLQTEEAVKIASQICDA
LDHAHMNQIIHRDIKPHNILIGNNGRVKVTDFGIARAVTSSTITQTGSVVGSVHYFSPEH
AKGVATGEKSDIYSLGIVLYQMLTGRLPFLGESPISVALKHLQEPFEQPRKVNPHIPQSV
ENVILRAMRKNPQERYASAQQMLSDLETCLQPQRVNEPPVRFGSDDDLESDKTRVIPAIR
PDMRNTLEAPAAKSAAPEERWDSRGLEDKPKRRWVMPTVLGVLAAVLIGVLIWAVVALKG
ELTPKDVLVPVVEGMEEQAAVDTLEKAGLKVEDPVIEEASKDVPEGHVIKQSKKDIKVKE
GSLITLTVSKGPDLPAMPDVTGKKLQEAQTALGALGINPDNIEPKEQYDDSEPGTVLDQD
PKPDELVDPETAKITLTVSKGKEEIAMPNLIGKTENEARAALEKSDLKLKDDKVILEASY
TAEKGKVFKQFPAEQNEMVPPGTEVTLWVSSGYPPEAKTVTWNVTVSPAQEGQESTIQII
YSDATGDNKVEGTHKIKRMTTFPVTLVLAPGKDGQITVSRDGTVIDSTPVPYADQPAGGT
EATTSPNPSPDNPPADGGQNGQDGDQGNGQ
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacaaacgctaggaaaccgttacgagctgctggcccgagtaggcggcggaggc
atggcgctcgtatacaaagcccgggacaacctgctcaaccgctatgtggccgtgaaggtg
ctgcgtcagcaattcatgcacgacgaggatttcatccgccgtttccggcgcgaggcgcag
gccgctgcgtccctgtcgcatccgaacatcgtcagcatttacgacgtcggacaggaagag
gatacgcattatatcgtcatggaattcgtcgacggggcgaatttgaacgaaatcatccgc
gagcgggcgccgctccagaccgaagaagcggtcaagatcgcttcccaaatctgcgacgcg
ttggaccatgcccacatgaaccaaatcatccatcgcgacatcaagcctcataacatattg
atcggcaacaacggaagggtgaaagtgacggacttcggcatcgcccgggccgtcacctct
tccaccatcacgcagaccggctcggtcgtcggttcggttcactacttctcgccggagcac
gccaaaggcgtcgcgacgggcgagaagtcggacatttactccctcggcatcgtgctgtac
cagatgctgacgggacgccttcctttcctgggagaaagcccgatcagcgtggcgctcaag
catttgcaggagccgttcgagcagccgcgcaaagtgaacccgcacattccgcaaagcgtg
gaaaacgtcattctccgcgccatgcgcaaaaatccgcaggagcgctatgcgtccgcgcag
cagatgctcagcgacctggaaacgtgcctgcagccgcagcgggtgaacgaaccgccggtc
cgtttcggcagcgacgacgacctcgaatcggacaagacccgcgtcattccggcgatccgc
ccggacatgaggaacacgctcgaagcgccggccgccaaaagcgccgcgccggaagagcgc
tgggattcccggggactcgaagacaagccgaaacgccgctgggtgatgccgaccgtgctc
ggcgtgctggcggccgtcctgatcggcgtgctcatctgggccgtcgtagcgctgaaaggc
gagctgacgcccaaagacgtgctcgttccggtcgtcgaaggcatggaggagcaagcggcg
gtcgatacgctggagaaggctgggctcaaggtcgaggatccggtcatcgaagaagccagc
aaagacgtgccggagggtcatgtcattaaacaatccaagaaggatattaaagtcaaggaa
ggctcgctcatcacgctgaccgtcagcaaaggccccgatctgccggcgatgccggacgtc
acgggcaaaaagctgcaggaagcgcaaaccgccctcggcgccctcgggatcaatccggac
aacatcgagccgaaggagcagtatgacgacagcgagcccggaacggtgctggaccaggat
ccgaagccggacgagctcgtcgaccccgaaaccgcgaagatcaccttgacggtgagcaag
ggcaaagaagagatcgccatgccgaacctgatcggcaaaacggagaacgaagcccgtgcc
gcactggagaagagcgacttgaagctcaaggacgacaaagtgattctggaagccagctat
acggcggaaaaagggaaagtgttcaaacaattccctgccgaacagaacgagatggttccc
ccgggcacggaagtgacgttgtgggtgagctccggttatccgccggaagcgaagacggtc
acttggaacgtgacggtgtccccggcccaggaaggccaggaaagcacgatccaaatcatc
tattcggacgcgacgggcgacaacaaggtggaaggaacgcacaaaatcaaacggatgacg
acgttcccggttacgctcgtgctggcccccggcaaggacggacagatcacggtgtcccgc
gacggcacggtcatcgacagcacgccggtgccgtacgccgaccagccggccggcggcacc
gaggccacgacgagtccgaatccgagtccggacaatccgccggccgatggaggccagaac
ggacaagacggcgatcaaggaaacgggcaatga

DBGET integrated database retrieval system