KEGG   Colwellia sp. MT41: CMT41_16685Help
Entry
CMT41_16685       CDS       T04159                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
com  Colwellia sp. MT41
Brite
KEGG Orthology (KO) [BR:com00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CMT41_16685
Enzymes [BR:com01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CMT41_16685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 DAO HI0933_like FAD_binding_2 FAD_oxidored NAD_binding_8 AlaDh_PNT_C Thi4 FMO-like K_oxygenase FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ALO36183
UniProt: A0A0S2JJK7
LinkDB All DBs
Position
complement(3942355..3943926)
Genome map
AA seq 523 aa AA seqDB search
MLDANLQAQLKSYLDNLKTPVELVTFTDESPKAKELSQLVNQIAELSPLVTAIDGNNTAQ
ASKERIPSMLVRSVASKSEIRFAGLPMGHEFTSLVMALLHSGSHPLKLDAEQIEQVRNLE
GEFEFETYISLSCQNCPDVVQALNMMAAINPQIKHTMIDGALFQTEVFDRDIMAVPSVYL
NGESFSQGRISLTDILNKVDKNSAARQAKALENKAVYDFLVVGGGPAGAAAAIYAARKGI
NTGLVADQFGGQVSDTLAIENFISVKATQGPKLVASLEEHVRDYDVDIMSGNKASQVKRN
EETGLIDVSLANGAVLSSKTVVLATGARWREMDVPGEHEYRGKGVAYCPHCDGPLFKGKR
VAVIGGGNSGIEAAIDLAGLVEHVTVLEFADRLRADDVLVRKANSLSNITIITHAQTTEV
LGDGKRVTSLSYTDRSTGENHELALAGIFVQIGLMPNSEFLQGDIELTNRGEIIVGSRGE
TSIAGVFAAGDVTDSPYKQIIIAMGSGATAALGAFDYLIRQDV
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgttagacgcaaatctacaagcacaattaaaaagttatttagacaatttaaaaacacca
gtcgagctagtcacctttactgatgaaagtcctaaggcaaaagaacttagccaattagta
aatcaaattgctgagttatcaccgttagttaccgccattgatggcaataatactgcccaa
gcgagcaaggaaagaatcccttctatgttagtgcgtagtgtcgctagcaagagtgaaata
cgttttgctggcttacctatgggccatgaatttacctcactggtgatggcgttattacac
agtggctcacatccgttaaaacttgatgcggagcaaatagaacaagtgcgtaaccttgaa
ggtgagttcgaatttgaaacttatatctcattaagctgtcaaaactgtcccgatgtggtg
caagccttaaatatgatggcggcgataaatccgcaaataaaacataccatgattgatggt
gcgctatttcaaaccgaagtatttgatcgcgatatcatggcggtacccagtgtttattta
aatggcgagtcatttagccaaggacgaatatcattaacggatattttaaacaaggtcgat
aaaaattctgctgctcgtcaagccaaagcgctggagaataaagcagtctatgacttttta
gtggtgggtggtgggccagcaggtgcggcagcggcaatttatgcggcacgaaaaggcatt
aatactggcttggtcgctgaccagtttggtgggcaagttagcgataccctagcgattgaa
aactttatttcggtaaaagccacccaaggaccaaaactggttgccagtttagaagaacat
gttcgagattatgatgttgatatcatgagtgggaataaagccagccaagtgaagcgtaat
gaagagaccggtttaattgacgttagcttagcaaatggcgcggtattgagtagtaaaacg
gtagtcttagcgacgggagcgcgctggcgtgaaatggatgtgccgggtgaacatgaatat
cgtggtaaaggtgtggcctattgtccgcattgtgacgggccattatttaaaggcaaacga
gtagcggttattggcggcggtaattcaggcattgaagcggccattgatttagccggtctt
gttgaacatgtgacggtattagaatttgctgaccgcttacgcgctgatgacgtattagtg
agaaaagcgaactcattaagcaatataacgattattactcatgcgcaaaccacggaagtg
ttaggtgatggtaagcgagtcactagcttgagttacactgatcgcagcacgggtgaaaat
catgagctagcattagccggtatttttgtacaaataggcttgatgccgaacagtgagttt
ttacaaggtgatatagagctaactaatcgcggtgaaattatcgtcggcagtcgtggtgaa
acgtcaatagcgggtgtctttgccgctggggatgttaccgatagtccatataagcaaatt
attatcgctatgggcagtggcgccactgccgccctaggagcttttgattatcttattcgc
caagatgtttaa

DBGET integrated database retrieval system