KEGG   Caldicellulosiruptor owensensis: Calow_0607Help
Entry
Calow_0607        CDS       T01347                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
cow00970  Aminoacyl-tRNA biosynthesis
cow01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cow00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Calow_0607
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cow03029]
    Calow_0607
Enzymes [BR:cow01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Calow_0607
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Calow_0607
Mitochondrial biogenesis [BR:cow03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Calow_0607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: ADQ04183
UniProt: E4Q4U1
LinkDB All DBs
Position
701676..703118
Genome map
AA seq 480 aa AA seqDB search
MEYEVVIGLEVHAELATKSKIFCSCTTEFGGEPNTHCCPICTGMPGVLPVLNKKAVEYAI
MAGLATNCQIARYSKQDRKNYFYPDLPKAYQISQYDLPLCYNGYIDIEVNGQKKRIGIKR
IHIEEDAGKLLHDQWEEGSLVDFNRCGVPLIEIVTEPDLRSSEETRVFLEKLKAILQYTE
VSDCKMQEGSLRVDVNLSVRPKGSKEFGTRTEMKNLNSFRSVVRAIEYEARRQIEVLESG
GVIVQETRRWDDAKGISLSMRTKEEAHDYRYFPEPDLPPIVVDDSWIEEIRKRIPELPDQ
KKERYIKEYGLPEYDAGVLTSSKAIASFFEECIKYTQNIKAASNWMMGEIMRILNDKGLE
PEEIDNIKIKPNQLASLINLVDNKTISNTIAKQVFEEMFDTGKDPEVIVKEKGLVQITDR
NVILEAVKQAIANNPKSVEDYKNGKDKAFGFLVGQVMKITKGKANPQLVNEILKEELEKI
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggaatatgaggttgtgataggtttagaggttcatgccgagcttgcaacaaaatcaaaa
atattttgcagttgcacaacagagtttggcggtgagccaaatacccactgctgtcctatt
tgcactggtatgccaggggtgcttcctgttttgaacaaaaaggcggttgaatatgccata
atggcaggtcttgcaacaaactgccaaatagcaagatacagtaagcaggatagaaaaaat
tatttttacccggaccttccaaaggcttaccagatttcgcagtatgacttgcctctctgt
tacaatggttatatagacattgaagtaaatggtcaaaaaaagagaataggaataaaaaga
attcatatagaagaggatgccggaaagcttcttcatgatcagtgggaagaaggaagtctt
gttgattttaacaggtgcggtgttcctttgattgagattgttacagagcctgatttacgt
tccagcgaagagacgcgagtttttcttgaaaaactaaaggcgattttgcaatacacagag
gtttctgactgcaagatgcaagaaggttcgctcagagtggatgtgaacctatctgtgcgc
ccaaaaggttcaaaagaatttggcacaagaacagaaatgaaaaacttaaactctttcagg
tctgttgtaagagctatagaatatgaggcaaggaggcaaatagaggttttagaaagcggt
ggtgttattgttcaggagacaaggcgctgggatgatgcaaaaggtataagtttatctatg
agaacaaaagaagaagcacatgactacaggtatttcccagagcctgaccttccacctata
gttgtagacgatagctggattgaggagattagaaagagaattcctgagcttcctgaccag
aaaaaggaaaggtatataaaagagtatgggttaccagaatatgatgccggcgttcttact
tcatcaaaggctatagcaagcttttttgaagagtgcataaaatatacacaaaacataaag
gctgcaagcaactggatgatgggagagattatgagaatcttaaatgataaagggttagaa
cctgaggaaattgacaatataaagattaaaccaaatcagcttgcaagccttattaatctt
gttgataacaagacaatttccaacactattgcaaagcaggtctttgaagagatgttcgac
acaggcaaagatcctgaagttattgtaaaagaaaaaggactcgttcagataacagacaga
aatgtaattttagaggctgtaaaacaggcgatagcaaacaatccaaaatcagtagaagat
tataaaaatggcaaagacaaggcatttggatttttggtggggcaggttatgaagataaca
aaaggcaaggcaaatccgcagcttgtaaatgaaatcttaaaagaggagcttgagaaaatc
taa

DBGET integrated database retrieval system