KEGG   Carica papaya (papaya): 110823716Help
Entry
110823716         CDS       T05151                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: glutamate decarboxylase 4
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cpap  Carica papaya (papaya)
Pathway
cpap00250  Alanine, aspartate and glutamate metabolism
cpap00410  beta-Alanine metabolism
cpap00430  Taurine and hypotaurine metabolism
cpap00650  Butanoate metabolism
cpap01100  Metabolic pathways
cpap01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    110823716
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110823716
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110823716
   00430 Taurine and hypotaurine metabolism
    110823716
Enzymes [BR:cpap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     110823716
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Met_gamma_lyase
Motif
Other DBs
NCBI-GeneID: 110823716
NCBI-ProteinID: XP_021909858
LinkDB All DBs
Position
Unknown
AA seq 510 aa AA seqDB search
MVLSKTSSESDVSVHSTFASRYVRTSLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMDAINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGESEAAIG
VGTVGSSEAIMLAGLAFKRKWQNMRKAQGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSEGYYVMDPVKAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLIEKNKQTGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRTKQDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGHEGYRNVMENCHENAMVLKEGLEK
TGRFDIVSKDHGVPLVAFSLKDNSRHDEFEVAEMLRRFGWIVPAYTMPADAQHITVLRVV
IRADFSRTLAERLVTDIVKVLHELDTLPARIGLAPVSGAAEEIEKKAQENGKINGVAVVV
KKTPEQTQREITAYWKKYVNDRKTNKNKIC
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggttctgtcaaagacgagttctgaatccgacgtttccgtccattccacctttgcttct
cgctatgtccgaacctcacttcctcggtttaagatgccggagaactcgataccgaaagag
gctgcttatcagataataaacgacgagttgatgcttgatggaaacccaaggctgaatctg
gcttcctttgtcaccacctggatggagccggagtgtgataagctcatcatggacgccatt
aataagaactatgttgatatggacgagtaccctgtcactacagagcttcagaatcggtgt
gtgaatatgattgctcatctgttcaacgcaccattgggagaatcagaggcagccattgga
gtaggaacagtgggttcatcagaagccatcatgttggctgggttagccttcaagcgcaaa
tggcagaacatgcgcaaggctcagggcaaaccctatgacaaacccaacatcgtcactggc
gccaatgtccaggtttgctgggagaaatttgcaagatactttgaggtggaactaaaggaa
gttaaactgagtgaaggttactacgtgatggacccagtgaaggcagtggaaatggtagat
gagaatacaatctgtgtggccgccattttgggttcaactctcaatggagaattcgaagat
gtcaaactcttaaacgacctgttaatcgaaaagaacaaacaaactggatgggatacgcct
atccatgttgatgcagctagtggagggtttattgcgccatttttgtacccagagcttgaa
tgggactttcgtttaccactggttaaaagtattaatgtgagtggacataagtatggattg
gtttatgctggtattgggtgggttatctggagaaccaaacaagatttgcctgaagaactc
atcttccacatcaactacctgggtgctgatcaacctactttcactctcaatttctccaaa
ggttctagccaagtaattgctcagtattaccaactcatccgattgggacacgaggggtac
cggaacgtgatggagaactgccatgaaaacgccatggtgttgaaggaaggattggagaag
acagggcggttcgacattgtttctaaagaccacggagtaccattagtggcgttctctctc
aaagacaacagtcgccatgacgagttcgaggtggccgagatgctccggaggttcggttgg
atcgtgccggcttacaccatgccggccgacgctcagcacatcaccgtgcttcgtgttgtc
atccgagcggacttttcacgcactctcgccgagaggttggtgacagacatcgtaaaagtg
ctccacgagctggatacacttccggccaggattggtctggctccagtgtcgggtgcagct
gaagagattgagaagaaggcccaagagaatggaaagattaatggcgttgccgtggtggtg
aagaaaacgcccgagcagactcagagggaaatcacagcttactggaagaagtacgtgaat
gataggaaaactaacaagaacaagatctgctag

DBGET integrated database retrieval system