KEGG   Clostridium pasteurianum BC1: Clopa_3518Help
Entry
Clopa_3518        CDS       T02645                                 

Definition
(GenBank) integral membrane protein, TerC family
  KO
K05794  tellurite resistance protein TerC
Organism
cpas  Clostridium pasteurianum BC1
Brite
KEGG Orthology (KO) [BR:cpas00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Clopa_3518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TerC
Motif
Other DBs
NCBI-ProteinID: AGK98305
UniProt: R4KFC0
LinkDB All DBs
Position
complement(3514211..3515047)
Genome map
AA seq 278 aa AA seqDB search
MSTKKILSRFLFWVAAAMIFNIGIYLFMGQVKALEFLGGYVIEQSLSMDNLFLFLIIFSS
FGVKVEYQRRILNYGIFGAIILRLIFIILGVAIVDKFHWILYVFGIVLIISGIKMILKKE
EDNQIDFKESKLIRVLNKIIPVKNNIEGEKFFVKEKGILYATPLFAILFFIEGSDILFAI
DSIPAIFSISTDTFIVYSSNIFAILGLRNLYFLLEKLQESFKYVKYGVAVILTFTGIKLS
ILFFHIEISILISILAIVGILAISILASVFTKENGAFE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaacgaaaaaaatattatcaagatttttattttgggttgcagctgcaatgattttt
aatattggaatttatttatttatgggacaagtaaaggcacttgaattcttaggtggatat
gtaattgaacaaagtcttagtatggataatttattcttatttttaataattttttctagc
tttggagttaaagttgaatatcaaagacgtatattaaactatggaatatttggtgcaatt
atattaagattaatatttattatattaggtgtagctatagtagataagtttcactggata
ttatatgtatttggtattgtacttattataagtggtataaagatgatattgaaaaaagaa
gaagacaatcaaattgattttaaggaaagtaagttgataagagtactaaataaaattata
cctgttaaaaataatattgaaggagaaaaattctttgtaaaagagaaaggtatactctac
gctaccccattatttgcaatattatttttcatagaaggatcagatatattatttgctatc
gattcaatacctgctattttttcaatatctacagatacatttatagtatatagttcaaat
atttttgccatattaggacttagaaatttgtactttttacttgagaaactgcaggaatcc
tttaaatatgttaaatatggtgttgcagtaatacttacttttactggcataaaattatcc
atattgtttttccatattgaaatatccatattaatatcaatacttgctattgtgggaatt
ctggcaataagtatactggcatctgtatttactaaagaaaatggagcttttgaataa

DBGET integrated database retrieval system