KEGG   Clostridium pasteurianum BC1: Clopa_3617Help
Entry
Clopa_3617        CDS       T02645                                 

Definition
(GenBank) hypothetical protein
Organism
cpas  Clostridium pasteurianum BC1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zn_dep_PLPC TetR_C_19
Motif
Other DBs
NCBI-ProteinID: AGK98399
UniProt: R4KCW8
LinkDB All DBs
Position
complement(3618668..3619264)
Genome map
AA seq 198 aa AA seqDB search
MIINTHILFSKIVYKHCLKELNFKLNKNIFMYGNIKPDISPDTFKSSHTLKDSIGIVSEY
FNELSNNKLDIKQFSMILGMICHYTADYFCIYHTEEYNKKNIFKHIVYEIALHVNLRILL
IKGKLKIIDSRSIPQRNVVSIIFNMQEKYFQKKRCFLTDIIYALSTITMVTESIIYFNIN
EFENIETYKLSKNIGGII
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgataataaatacacatatattattttctaaaattgtatataaacattgtttaaaagaa
ctaaattttaaattaaacaaaaatatttttatgtatggaaatattaagcctgacatttct
cctgatacctttaaaagttcccatactttaaaggatagtataggtattgtgtctgaatat
tttaatgaattatctaataataaattagatattaagcagttctcaatgattctagggatg
atatgccattatacagcagactatttttgtatatatcatactgaagaatataataaaaaa
aatatttttaaacatatagtctatgaaatagctcttcatgttaatctaagaattcttctt
ataaaaggtaaactaaaaataattgatagcagaagtatacctcaaagaaatgtagtatca
attatttttaatatgcaggaaaagtattttcaaaaaaagaggtgttttttgacggatata
atttatgcgctatcaaccatcactatggtaacagaatcaataatttattttaatattaat
gaatttgaaaatatagaaacctataaactatcaaaaaatataggagggataatatga

DBGET integrated database retrieval system