KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ002102
Entry
CpipJ_CPIJ002102  CDS       T01079                                 

Definition
(GenBank) apoptosis 1 inhibitor
  KO
K16061  baculoviral IAP repeat-containing protein 7/8
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04120  Ubiquitin mediated proteolysis
cqu04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    CpipJ_CPIJ002102
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    CpipJ_CPIJ002102
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cqu01002]
    CpipJ_CPIJ002102
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cqu04121]
    CpipJ_CPIJ002102
Peptidases and inhibitors [BR:cqu01002]
 Peptidase inhibitors
  Family I32: IAP family
   CpipJ_CPIJ002102
Ubiquitin system [BR:cqu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    CpipJ_CPIJ002102
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_2 zf-RING_UBOX
Other DBs
NCBI-ProteinID: EDS32233
VectorBase: CPIJ002102
UniProt: B0W3T6
LinkDB
AA seq 409 aa
MTAQVLSIPRDYTDNKVKDENTSYGLTGTSVTYHIEVSRLESFLNWSIPFISKFELARFG
FYYVGPGDMVKCFFCRVEIGLWEPNDNVLSEHLRWSPYCPLLRKRPTNNQPLDASFLDQL
PEPSYDTCGIQIRQHSVAENAYSSSDRSSSGSMSSPPSSLTSESSMMSNTSGGVGATELQ
PPQQQHKLPEYPNYAIEAKRLESYEDWPKFMKQKPKELSDAGFFYTGKSDRVKCFSCGGG
LKDWEAGDEPWEQHAMWYSNCEYLKLMKGEEYIAQCLAKKENSSEMSEQPQDVGPSSSPQ
PSTSGVASAATTSLPSSQSSSLSTSVEESNPMTSMAAPMSGSSGLEEDEDEPNRKQDTSR
TCKICYVNEYNTAFSPCGHVVACAKCASSVTKCPLCRKPFTNVMRIYLM
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgaccgcgcaagttctatcaataccacgggattatactgataacaaagtgaaggatgaa
aacacatcgtacggattaacggggacatcagtgacataccatatagaagtgtctcggctg
gaatcgtttttaaactggagcataccgttcatcagcaagttcgagttggctcggtttgga
ttttattatgtggggccgggtgacatggtgaagtgcttcttctgtcgggttgaaattgga
ctgtgggagccgaatgataatgtgttatcggaacacttgcggtggtctccgtactgtccg
ttgctgcgcaagcgcccaacaaataatcaaccgctcgatgcaagtttcctggaccaactg
ccggagcccagctatgatacctgtggtatccagattaggcagcactccgtggcagagaat
gcgtactcgtcgtcggacagaagcagcagcggatcgatgtcctcgccaccgagctcgttg
acgtccgagtcaagtatgatgtccaatacgtccggaggtgtcggagcaactgaactacag
ccaccccagcagcagcacaaacttcccgaatatcccaactatgctatcgaagcgaagcgg
ctagaaagctacgaagactggccaaagtttatgaagcaaaagccgaaggaactcagcgat
gctggattcttctacacgggcaagagcgatcgagtcaagtgcttcagctgtgggggaggt
ctgaaggactgggaggccggggatgagccctgggagcaacatgctatgtggtatagcaac
tgtgagtacctgaaacttatgaagggcgaagagtacatcgcccagtgcttggccaagaag
gaaaattcttcggaaatgtccgagcagccgcaggacgtcggcccatccagctccccgcag
ccgtcaacgtccggagtcgcgtcggcggccaccacctcgctaccttcatcacagtcatcc
agtctgagcacttcggtcgaagaaagcaatcctatgacatcgatggcggcacccatgtcc
ggcagcagtggcctcgaggaagacgaggacgaaccgaaccgcaagcaggacacgagccga
acgtgcaaaatttgctacgtcaacgagtacaacaccgcgttctcaccgtgtggccacgtt
gtggcgtgtgccaagtgcgcctcgtcggtcaccaagtgtcccctgtgccggaagcccttt
accaatgtgatgcgaatttacctgatgtga

KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ006918
Entry
CpipJ_CPIJ006918  CDS       T01079                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K16061  baculoviral IAP repeat-containing protein 7/8
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu04120  Ubiquitin mediated proteolysis
cqu04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    CpipJ_CPIJ006918
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    CpipJ_CPIJ006918
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cqu01002]
    CpipJ_CPIJ006918
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cqu04121]
    CpipJ_CPIJ006918
Peptidases and inhibitors [BR:cqu01002]
 Peptidase inhibitors
  Family I32: IAP family
   CpipJ_CPIJ006918
Ubiquitin system [BR:cqu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    CpipJ_CPIJ006918
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-ProteinID: EDS28512
VectorBase: CPIJ006918
UniProt: B0WII9
LinkDB
AA seq 199 aa
MASLTIPKAPKKFQPGGHLSTRACETPISSGSSFGDAMSQIEFDAGPYEEESEQDFGRFK
FNARFQEYNGLRSRLMTFDAVAQWSGPKVSLLAEAGFFYTGVRDVVACFYCGLRLAEWKQ
SESPWWMHALHVPEDGCDYLSHMKGKRYAESRGRRPSLAEPKWCFDADRNDGGDWVPCAD
KLACALCLWEEWMTPAGLN
NT seq 600 nt   +upstreamnt  +downstreamnt
atggcttccttgaccataccgaaagcaccaaaaaagtttcagccgggtggccacttatca
accagggcttgtgaaacaccgatcagcagcggaagtagcttcggagacgccatgagccaa
atcgagttcgacgccggtccgtacgaggaagaatcggagcaggactttggtcggttcaag
ttcaacgcccgattccaagagtacaacggacttcgcagccgcttgatgaccttcgacgcc
gtagcccagtggagtggacccaaggtgagcctgctggcggaggctggattcttctacacc
ggcgtgcgggacgtggtcgcgtgcttctactgtgggctgcggttggccgagtggaagcag
agcgagagtccctggtggatgcatgccttgcacgtgccggaagacggttgcgactatctg
agccacatgaagggtaagcggtacgcggaaagtcgaggacggcggccgagtttggcggaa
ccaaagtggtgcttcgatgcggacaggaacgacggtggggattgggttccctgtgcggac
aagttggcttgcgcgttgtgcctgtgggaagagtggatgacgccggctggactgaactga

DBGET integrated database retrieval system