KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ007058
Entry
CpipJ_CPIJ007058  CDS       T01079                                 

Definition
(RefSeq) hypothetical protein
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00230  Purine metabolism
cqu01100  Metabolic pathways
cqu04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CpipJ_CPIJ007058
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    CpipJ_CPIJ007058
Enzymes [BR:cqu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     CpipJ_CPIJ007058
SSDB
Motif
Pfam: AC_N
Other DBs
NCBI-GeneID: 6038888
NCBI-ProteinID: XP_001848587
VectorBase: CPIJ007058
UniProt: B0WIQ3
LinkDB
AA seq 307 aa
MDKSIVPADGNPAASNLPTSTVLLPDDVLEKLYQSYALKQKRVAFGCYLAASILFDVWAI
LVPQGQGWESIVVTSVFLTLNVTLAAILRFCGKSRFRGFIWEVAPHAAWLLAIKQLFLQL
FLKGSVTPRDSLGWAVLLNFLVYVTLPVLLKYTGILLGLGSFATYVNAIIGLAKKENYFW
EQQIANILLLVAATAIGLLVYFLAEAKQRRAFLEAKQGLEVKMLIEEQSAEQERLLLSVL
PEHVAVKMRQDLGSTNSEQFKKIYMSRHENVSIFQRGVPPPRRRSRSNRSQAHRLMLRSV
PRESAGY
NT seq 924 nt   +upstreamnt  +downstreamnt
atggataaaagcatagtgccggcggacggaaacccggcggccagcaacctgcccacgtcg
acggtgctcctgccggacgatgtgctcgagaagctgtaccagagctacgccctcaaacag
aaacgggtcgccttcgggtgctatctggccgcgtcgatactgttcgacgtgtgggccatc
ctggtgccccagggccagggctgggagagcatagtggtaacgagcgtgttcctaaccctg
aacgtcacgctggcggcgatactgcgcttctgcggcaagagccgtttccggggcttcatc
tgggaggtggctccgcacgcggcctggctgctcgccatcaaacagctcttcctgcagctg
ttcctcaaaggatccgtcacgccgagggattcccttggctgggcggtgctgcttaatttt
ttagtgtacgtcaccctgccggtcctgctgaagtacaccggcatcctgctggggctggga
tcgttcgcaacctatgtcaacgccatcattgggctggccaagaaggagaactatttctgg
gaacagcaaattgccaacatccttctgctggtagcggccaccgccatcgggctgctcgtc
tacttcctagccgaagccaaacaacgaagagcttttctcgaagcaaagcagggcctagag
gtgaagatgctgatcgaggagcagtcggccgagcaggaacgattactcctatcggtgctg
cccgagcacgtcgcggtgaaaatgcgacaagatctaggatcaacaaactcggagcagttc
aagaaaatctacatgagtcgtcacgaaaatgtcagcattttccaacgaggagtgccccct
ccccggcgtcgttcgcggtccaaccgcagccaagcgcatcgattgatgctgcgctcggtt
ccgcgtgaaagtgccggttattaa

DBGET integrated database retrieval system