KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ011633Help
Entry
CpipJ_CPIJ011633  CDS       T01079                                 

Definition
(RefSeq) short-chain specific acyl-CoA dehydrogenase, mitochondrial
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
cqu00071  Fatty acid degradation
cqu00280  Valine, leucine and isoleucine degradation
cqu00410  beta-Alanine metabolism
cqu00640  Propanoate metabolism
cqu00650  Butanoate metabolism
cqu01100  Metabolic pathways
cqu01200  Carbon metabolism
cqu01212  Fatty acid metabolism
Module
cqu_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CpipJ_CPIJ011633
   00650 Butanoate metabolism
    CpipJ_CPIJ011633
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CpipJ_CPIJ011633
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CpipJ_CPIJ011633
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CpipJ_CPIJ011633
Enzymes [BR:cqu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     CpipJ_CPIJ011633
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 Acyl-CoA_ox_N
Motif
Other DBs
NCBI-GeneID: 6044292
NCBI-ProteinID: XP_001861823
VectorBase: CPIJ011633
UniProt: B0WWQ1
LinkDB All DBs
AA seq 453 aa AA seqDB search
MFDLSLQREYKPRNTALDKVYLPEWDEICVTVPKRFERTLVEKIQNTPEVTQFNQHGDKV
QNDKLSKSIASLDALPETHQMLQKTCRDFADSELVPVAAKIDREHCYPAEQIARAGDLGL
MAITLSERYGGTGLDYMAYAIAMEEVSRGCPSIAVTMSIHNSLYLGLLEKYGSEEQKERF
LPGFLDGRRIACFALSEPGNGSDAGAASTTATLKGDRWVLNGTKCWISGGYEATNGIVFA
TTDKSLKHKGISAFVVPMDSKGLSRGKNEDKLGLNGSSTCQLIFEDCEIPKDNLIGQPGY
GFKIAMQSLDAGRIGVAGQALGIAQASLECAVDYANKRTAFGKPISKLQMIQSKIADMSV
RLESARLLTWRAAWLKDNKHPFTKEAAQAKLAASETATFCAHQCMQVLGGMGYVTDMPAE
RYYREARITEIYEGTSEIQRLVIAGQVIKELST
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatttaagtctacaaagggaatacaagccacgcaacacggctctggacaaggtc
tacttgccggaatgggatgaaatctgcgtaactgttccaaagcggttcgagaggactctg
gttgagaagattcaaaatacgcctgaagtcacgcagttcaaccagcacggcgacaaagta
cagaacgataagctgagtaagtccatcgccagcttggacgccctgccggaaacgcaccag
atgctgcagaagacgtgccgggactttgccgacagcgagctggtgccggtcgcggccaag
atcgaccgcgagcactgctatccggcggagcagatcgcccgcgctggagacttgggcctg
atggcgatcacgttgagcgagcggtacggtgggaccggactggattacatggcgtacgcg
atcgccatggaggaggtttcgcgcgggtgcccgtcgattgcggttacgatgtcgatccac
aactcgctgtacttggggctgctggagaagtatggcagtgaggagcagaaggagcggttt
ttgccggggtttttggacgggaggaggattgcgtgctttgcactgtccgaaccggggaac
gggtcggatgctggggctgcgtcgacgacggcgacgttgaagggagatcgctgggttttg
aacgggaccaagtgttggatatcgggtgggtacgaagctaccaatgggattgtgtttgct
acgacggataagagcttgaagcacaaggggatttcggcgtttgtggtgccgatggattcg
aaggggttgagcagggggaagaacgaggacaagctcgggcttaatgggtcgtcgacgtgt
cagctgatattcgaggactgtgagattcccaaggacaacctgattggtcaacctgggtat
ggtttcaagatcgctatgcaatctctggacgcagggcgtatcggggtggccggacaggct
cttgggatcgcgcaagcttcgctggagtgtgccgtcgattatgccaacaagcggactgcc
ttcggaaagccgatctccaagctgcagatgatccaaagcaagatcgcggacatgtccgtg
aggttggaatcggcgcgacttcttacgtggagagccgcctggttgaaggataacaagcat
ccgttcacgaaggaagctgcccaggccaagctggcggcctcggagacggctacgttctgt
gcccaccagtgtatgcaggttctcggcggaatgggctacgtgacggacatgcctgcggaa
cggtactaccgggaggcgaggattacggaaatctacgagggcacctcggaaattcaacgg
cttgtcatcgctgggcaagtgattaaggagctatctacttaa

DBGET integrated database retrieval system