KEGG   Capsella rubella: 17899705Help
Entry
17899705          CDS       T02984                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
crb  Capsella rubella
Pathway
crb03030  DNA replication
crb03410  Base excision repair
crb03420  Nucleotide excision repair
crb03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:crb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    17899705
   03410 Base excision repair
    17899705
   03420 Nucleotide excision repair
    17899705
   03430 Mismatch repair
    17899705
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:crb03032]
    17899705
   03400 DNA repair and recombination proteins [BR:crb03400]
    17899705
Enzymes [BR:crb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     17899705
    6.5.1.6  DNA ligase (ATP or NAD+)
     17899705
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     17899705
DNA replication proteins [BR:crb03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    17899705
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     17899705
DNA repair and recombination proteins [BR:crb03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     17899705
   NER (nucleotide excision repair)
    Other NER factors
     17899705
   MMR (mismatch exicision repair)
    Other MMR factors
     17899705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-GeneID: 17899705
NCBI-ProteinID: XP_006303909
UniProt: R0GLG7
LinkDB All DBs
Position
Unknown
AA seq 793 aa AA seqDB search
MLAIRSSNYLRCIPCLSTKTQFSQFSSVLLSFSRRVSHLRLSSCYRAMSSSRPSAFDALM
SNARAAAKKKTPQTSALSRSPNKRKIAETQDANLTKTLVSEGTLPKAEDPVELVSDSANP
RSDKSSIAEDSKAGAKKSRTLSKTDKIDEMKSKIGMLKKKPNDFDPEKMCCWEKGERVPF
LFLALAFDLISNESGRIVITDILCNMLRTVIATTPGDLVATVYLSANEIAPAHEGIELGI
GEGSIIKAISEAFGRTEDQVKKQNTELGDLGLVAKGSRSTQTMMFKPEPLTVVKVFDTFR
QIAKETGKDSTEKKKNRMKALLVATTDCEPLYLTRLLQAKLRLGFSGQTVLAALGQAAVY
NEEHSKPPPNTKSPLEEAAKIVKQVFTVLPVYDIIVPALLSGGVWNLPKTCNFTLGVPIG
PMLAKPTKGVAEILNKFQDIVFTCEYKYDGERAQIHFMEDGTFEIYSRNAERNTGKYPDV
AIALSRLKKPSVKSFILDCEVVAFDREKKKILPFQILSTRARKNVNVNDIKVGVCIFAFD
MLYLNGQQLIQENLNIRREKLYESFEEDPGYFQFATALTSSDIDEIQKFLDASVDVGCEG
LIIKTLNSDATYEPAKRSNNWLKLKKDYMDSIGDSVDLVPIAAFHGRGKRTGVFGAFLLA
CYDVDKEEFQSICKIGTGFSDAMLDERSSSLRSQVIATPKQYYRVGDTLNPDVWFEPSEV
WEVKAADLTISPVHRAATGIVDPDKGISLRFPRLLRVREDKKPEEATSSEQIADMYQAQK
HNHPSNEGKGDDD
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgttagcaattcgatcatcaaattacctccgatgcataccctgtctctctactaaaacc
caattctctcagttctcctccgttttgctgtcttttagccgcagagtttcccacttgcgt
cttagctcgtgctacagagccatgtcttcttcccgcccttctgcatttgacgctcttatg
tcaaatgctcgcgcagctgccaagaagaagacgcctcagacctccgccttgtctcgttct
ccgaacaaaaggaaaattgcggaaacccaagacgctaatttgaccaaaactcttgtttcc
gaaggtacactaccgaaagctgaggatcccgtggagcttgtttctgattccgcaaacccc
agatcggataagtcgtcaattgcggaagactcgaaggccggagccaaaaagtctaggact
ttgagcaaaacggataaaattgacgaaatgaagagcaaaattggaatgttgaagaagaag
cccaatgatttcgatcctgagaaaatgtgttgctgggagaaaggggagagggttccgttt
ctgtttctggcattggcttttgatctgatttcaaatgaaagtggccgaattgtgattacc
gatattctgtgtaacatgttgagaaccgttattgccaccacgcccggagatttggttgct
actgtttatctttctgcgaatgagattgctcctgctcatgaaggtatagaattgggaatt
ggtgagggttcaatcatcaaggcaatctctgaagcttttggtagaactgaggatcaagtg
aagaagcagaatacggaactgggagacttggggcttgtagcaaaaggaagccgttcgact
cagactatgatgtttaagcccgaaccattgactgttgtcaaggtttttgatacatttcga
caaattgctaaggaaactggaaaagatagtacggaaaagaagaagaatcgaatgaaggca
cttcttgtggcaacaacagactgtgaacctctatacttaacacgtttacttcaggcgaaa
ttgcggttagggttctcaggtcagactgtcttagctgctttgggacaagcagctgtatat
aatgaagagcactcaaagccgcccccgaataccaagtctcctttagaagaggctgcgaaa
attgttaaacaagtcttcactgtgcttcctgtctatgacattattgttcctgctcttcta
tctggtggtgtgtggaatcttccaaaaacttgtaattttacactgggtgttccaattgga
cccatgcttgcaaaaccaaccaaaggtgtagcagagatactgaataaattccaggacata
gttttcacatgcgaatacaaatatgatggcgaacgtgcacagatacattttatggaggat
ggtacatttgagatatacagtcgaaatgcggaaagaaacactgggaagtacccggatgtt
gcgattgcgttatcaagattaaagaagccgtctgtgaagtcttttattttggattgtgag
gttgttgctttcgacagggagaaaaagaaaattcttccattccagattttaagcactcga
gcccgtaaaaatgtgaatgtcaatgatattaaggttggcgtatgcatctttgcttttgac
atgttatatctaaatggccaacaacttatccaggagaatcttaatattcgccgagagaag
ctatacgaatcatttgaggaagatcctggttatttccagtttgcaactgctctaacatcg
agcgacatcgatgaaatacaaaagtttcttgacgcttctgttgatgttggctgtgaaggt
ttaatcattaaaacattgaattcggatgctacatatgagcctgcaaagcgatcaaataat
tggctaaaattgaagaaagactatatggacagcattggagactctgtggatcttgtacca
attgctgcttttcatggacgtggcaaacgcacaggtgtctttggtgcatttttactcgct
tgttacgatgttgataaggaagagttccaaagcatttgtaaaatcggtactggattttct
gatgccatgcttgacgagcggtcgtccagtcttcgctctcaagtgattgctactccaaaa
caatactaccgagttggagataccctcaatccagatgtttggtttgagcccagtgaggtc
tgggaagtgaaagcagctgacttgacaattagccctgtgcaccgtgcagctaccggcatt
gtggaccctgataagggaatttctcttcgctttcctcgtctgctccgtgtacgggaagac
aagaagccagaggaagcaacatcatccgagcagattgcggatatgtaccaagctcagaaa
cacaatcatccaagcaatgaaggcaaaggtgacgatgattga

DBGET integrated database retrieval system