KEGG   Corynebacterium resistens: CRES_0950Help
Entry
CRES_0950         CDS       T01538                                 

Gene name
thiO
Definition
(GenBank) amino acid oxidase flavoprotein
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
crd  Corynebacterium resistens
Pathway
crd00730  Thiamine metabolism
crd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CRES_0950 (thiO)
Enzymes [BR:crd01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     CRES_0950 (thiO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_9 NAD_binding_8 ThiF Sacchrp_dh_NADP FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEI09306
UniProt: F8E1N9
LinkDB All DBs
Position
complement(1157671..1158879)
Genome map
AA seq 402 aa AA seqDB search
MKGAPPSMKTYPHVLIGAGIIGLTTAVELLRAGVDAREIAIVDPSPISGASWVAGGMLAP
VAEVQYGQEQLYPLMVRAAELWPELVSFVQARTDLPTGYREDSTLVVAADRADATHLSEL
MAHQNSHGMDVHRIPTRRARQLEPGLSPQLAGAVEIPGDHQINPRLFCAATMDVLANAGV
TFIERKAVKLVHKSGGCAEVVFDGGDPVGVGQSVYLCNGLGGNYVKDAPYLPLRPVRGDL
VRLAVPEQLHAPVDRVVRGFVEDRPIYVIPRTDGTIALGATSREDNRQKPSADGVYTLLR
DAIRVVPGLEECEFLEAIAGARPGTPDDLPLLGKVGTNVVVSNGYFRHGILLSALGAKVS
AVLGLSDGAEVNGPAESLKAASEAVGVDMSACAFDRFNNEGV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggagcgccgccgtcaatgaagacgtatccccatgtgctcatcggtgcagggatc
attggtctcacgacagccgtggagctgcttcgggcaggtgttgatgcacgtgaaattgcg
atcgtggatccttcgccaatcagtggagcttcttgggttgccgggggcatgctcgcgccc
gtggcggaggtgcagtacgggcaagaacagctgtatccgctgatggtgcgcgccgcggaa
ctatggccggagctggtgagttttgtgcaggcacgcaccgatctgcccaccggctaccgg
gaggattcaaccctcgtggtcgccgccgatcgtgcagatgccacgcacctttcggagctg
atggcgcaccaaaatagtcacggtatggatgtccaccgcatacccacccggcgagcgcgc
caactagaaccaggattatcaccacagctcgcgggtgcggtggagatccccggcgatcat
caaatcaatccccgtttgttctgcgcggccactatggatgtgctggccaacgcgggagtc
accttcattgagcgcaaggctgtgaagctcgtccacaaatctggcgggtgtgctgaagtg
gtattcgatggcggggatccggtgggcgtcggtcaaagtgtgtacctctgcaacggactg
ggcggaaactacgtaaaagatgcgccatacttgccgctgcgaccagtgcgcggagacctt
gtgcgtttggcggtccccgaacagctgcacgctccggtggatcgtgtggttcggggattc
gtggaggatcggccgatctacgtgattccacggacggatggcacgattgctctgggagcg
acgagccgagaagacaatcggcaaaaacccagcgcggatggggtctacaccctgttaagg
gatgcgattcgtgtggttccgggactagaggaatgtgagttcctcgaggccatcgcgggt
gctcggccgggcactccagacgatcttccgctgctagggaaggttgggacgaatgtggtg
gtttccaatggatacttccggcatgggattttgttgtcagcgttgggcgctaaagtgagc
gctgtgcttgggttgagcgacggggccgaggtcaatgggccagctgaatctttgaaagcc
gcctcggaagcagtaggcgtggatatgagtgcgtgtgcattcgatagattcaacaatgaa
ggagtgtga

DBGET integrated database retrieval system