KEGG   Citrobacter rodentium: ROD_29931
Entry
ROD_29931         CDS       T01145                                 
Symbol
escN
Name
(GenBank) T3SS translocator EscN
  KO
K03224  ATP synthase in type III secretion protein N [EC:7.4.2.8]
Organism
cro  Citrobacter rodentium
Pathway
cro03070  Bacterial secretion system
Module
cro_M00542  EHEC/EPEC pathogenicity signature, T3SS and effectors
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_29931 (escN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_29931 (escN)
Enzymes [BR:cro01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     ROD_29931 (escN)
Secretion system [BR:cro02044]
 Type III secretion system
  Type III secretion core apparatus
   ROD_29931 (escN)
SSDB
Motif
Pfam: ATP-synt_ab T3SS_ATPase_C DUF87 ABC_tran RsgA_GTPase
Other DBs
NCBI-ProteinID: CBG89725
UniProt: D2TKF5
LinkDB
Position
complement(3164704..3166044)
AA seq 446 aa
MISEHNSMLERYPRIQKVINSTLPALLFNSSTKYEGKITNIGGTIIKARLPNARIGAFYK
IEPGQRLAEVIAINGDEVFLLPFEHVSGMYCGQWLSYQGEEFKIRVGDELLGRLVDGIGR
PMGSNIATLYLPFKRSLYAEPPDPLLRQVIDQPFTLGVRAIDGLLTCGIGQRIGIFAGSG
VGKSTLLGMICNGASADIIVLALIGERGREVNEFLALLPQSTLSKCVLVVTTSDRPALER
MKAAFTATTIAEYFRDQGKNVLLMMDSVTRYARAARDVGLASGEPDVRGGFPPSVFSSLP
KLLERAGPAPKGSITAIYTVLLESDNVNDPIGDEVRSILDGHIVLTRELAEENHFPAIDI
GLSASRVMHNVVKSEHLRAAAECKKLIATYKNIELLIRIGEYTMGQDPEADKAIKNRKAI
QSFLQQSTKDISSYEKTIENLFKVVA
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgatttcagagcataattctatgttggaaagatacccacgtatccagaaagtgatcaat
agcaccttgccggcattattattcaattcatccacaaagtatgaaggcaagattactaat
attggcgggacgattatcaaggctcgtttaccaaatgcccgtattggcgccttttataag
atagaacccggtcaacgtttagctgaggtgattgctattaatggggatgaggttttcttg
ctaccttttgagcatgtttctggcatgtattgtgggcagtggctaagttatcagggagaa
gagttcaagattcgtgttggtgatgaactgcttgggcgacttgttgatggcataggcagg
ccaatggggagcaatattgctacgctttatcttccgtttaaacgcagcctgtatgcggaa
ccaccagatcctttattaaggcaggttattgatcagccatttacgcttggggttagggca
attgatggtttgcttacttgcggtattgggcagcgcatcggtattttcgctggttccggc
gttggtaaaagtacgcttctggggatgatttgtaatggcgcatcagcggatattattgtc
cttgcccttatcggtgagcgtggtcgtgaagtaaatgaatttcttgcgcttttaccccaa
tctacgctttctaaatgcgtactggttgttacaacttcagaccgtcctgctctggaaaga
atgaaagccgcatttacggcgacaaccattgctgagtatttccgggatcaggggaaaaat
gtattattaatgatggactccgtaactcgttatgcccgagcagcacgtgatgttgggctt
gcatcgggggaaccggatgtaaggggaggattccccccgagtgttttttcttcgttaccc
aaattattagagcgtgcgggccctgcgccaaaagggtcaataactgcgatttatacggtg
cttttagaaagcgacaatgttaatgatcctattggtgatgaagttcgctctattcttgat
gggcatatagtgcttacacgagaacttgcagaggaaaaccattttcctgcaattgatatt
ggtttaagtgctagtcgtgttatgcataacgttgttaaatcggaacatttacgtgcggcg
gcagaatgcaaaaagcttattgcaacctataaaaatattgagctgcttattcgtattggt
gagtacacgatggggcaagatcctgaagcggataaggctataaaaaatagaaaagcaatc
cagagttttttacagcaaagtactaaagatatcagtagttatgaaaaaacgattgaaaat
ctattcaaagtggttgcctga

DBGET integrated database retrieval system