KEGG   Citrobacter rodentium: ROD_34491Help
Entry
ROD_34491         CDS       T01145                                 

Definition
(GenBank) putative glutathione S transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cro  Citrobacter rodentium
Pathway
cro00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ROD_34491
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cro02000]
    ROD_34491
Enzymes [BR:cro01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ROD_34491
Transporters [BR:cro02000]
 Other Transporters
  Pores ion channels [TC:1]
   ROD_34491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: CBG90163
UniProt: D2TPX6
LinkDB All DBs
Position
3637353..3638021
Genome map
AA seq 222 aa AA seqDB search
MLTVHHLNQSRSQRILWALEELSLPYQIVRYQREKSMLAPPALKKVHPLGKSPVVEDNGA
ILAESGAILEYLQETYDREGKFKPAEAEAKRQYRFWLHYAEGSLMPLLLMKLVFVSLGKP
PVPFGLRTLGGALGKGVQKAYLNPQLETHARFIDAHLATHSWFAGEQFSMADIQMSFPLF
ALLARGGIDNLTHIQAWKKRVELRPAWQRAIQQGGPFDLPGG
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgctgacggtgcaccatttaaatcagtcccgatcccagcgcatcctctgggcgctggaa
gagttatcgctgccgtatcagattgtccgctaccagcgtgaaaagagtatgctcgcgccg
ccagccctgaaaaaagtgcacccgctgggcaagtcgccggtagtggaagataacggcgcg
atcctcgccgagtccggggcgattctcgaatacctgcaggaaacctacgatcgcgaaggc
aaatttaagcccgctgaggcagaggcgaagcggcagtatcgtttctggctgcactatgcg
gaaggctcgctgatgccgctgctgctgatgaagctggtattcgttagcctgggcaaaccg
ccggtgcctttcggtttgcgcacgctgggcggcgcgttgggaaaaggggtacaaaaagcg
tatctcaacccgcagctggagacccatgcccgctttattgacgcgcatctggccacccat
tcctggtttgccggcgagcagttcagcatggcggatattcagatgagcttcccgctgttt
gccctgctggcccgcggcggtatcgacaacctcacccacatccaggcgtggaaaaagcgg
gtggagctgcgtccggcctggcagcgggcaattcagcagggcgggcctttcgaccttccc
ggcggctga

DBGET integrated database retrieval system